FC868799

Overview
NameFC868799
Unique NameFC868799
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length717
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDD1_ARATH (Phospholipase D delta OS=Arabidopsis thaliana GN=PLDDELTA PE=1 SV=2)

HSP 1 Score: 374.4 bits (960), Expect = 3.351e-103
Identity = 172/239 (71.97%), Postives = 200/239 (83.68%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAHPQDYLSFYCLGKREEAPKDVLANNGDKVSDSQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEFTPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIGVHSMSLP 717
            ERFAVYV+IP+WPEGDPK+  VQEIL+WQSQTMQMMY V+A+EL+ +Q DAHP DYL+FYCLGKRE+ P D+ A NG  VSDS   QRFMIYVHAKGMIVDDEYV+MGSANINQRSMAG+KDTEIAMG+YQP+HTWA K +HP GQ+YGYR SLW+EHLG   + F EP  L+C++KVN I+ ENW RF   +F+ LQGHL++YPLQVD DG VSPLP YE FPD GGKIIG HSM+LP
Sbjct:  625 ERFAVYVVIPLWPEGDPKSGPVQEILYWQSQTMQMMYDVIAKELKAVQSDAHPLDYLNFYCLGKREQLPDDMPATNGSVVSDSYNFQRFMIYVHAKGMIVDDEYVLMGSANINQRSMAGTKDTEIAMGAYQPNHTWAHKGRHPRGQVYGYRMSLWAEHLGKTGDEFVEPSDLECLKKVNTISEENWKRFIDPKFSELQGHLIKYPLQVDVDGKVSPLPDYETFPDVGGKIIGAHSMALP 863          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDB2_ARATH (Phospholipase D beta 2 OS=Arabidopsis thaliana GN=PLDBETA2 PE=2 SV=2)

HSP 1 Score: 295.819 bits (756), Expect = 1.515e-79
Identity = 134/240 (55.83%), Postives = 178/240 (74.17%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELRE--MQVDAHPQDYLSFYCLGKREEAPKDVLANNGDKVSDS------QKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEFTPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIG 696
            ERFA Y++IPMWPEG P     Q IL+WQ +TMQMMY  +   L E  ++ +  PQDYL+F+CLG RE    +  +  G   +++      +K++RFMIYVH+KGM+VDDEYV++GSANINQRSM G++DTEIAMG+YQP HTWAR+Q  P GQIYGYR SLW+EH+ +LD+CF EPESL C+RKV  +A ENW +F + E + ++GHL++YP++VD  G V PLPG E+FPD GG ++G
Sbjct:  665 ERFAAYIVIPMWPEGVPTGAATQRILYWQHKTMQMMYGTIYNALVEAGLEDEYSPQDYLNFFCLGNREMVNGNNESGTGSASNENTPQGLCRKSRRFMIYVHSKGMVVDDEYVVIGSANINQRSMEGTRDTEIAMGAYQPQHTWARRQSGPRGQIYGYRMSLWAEHMALLDDCFVEPESLGCVRKVRTVAEENWEQFRSEEVSEMRGHLMKYPVEVDRKGKVRPLPGSEEFPDVGGNVVG 904          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDG3_ARATH (Phospholipase D gamma 3 OS=Arabidopsis thaliana GN=PLDGAMMA3 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.282e-78
Identity = 136/247 (55.06%), Postives = 182/247 (73.68%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAH--PQDYLSFYCLGKREEAPKDV------LANNGDKVSD-------SQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEFTPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIG 696
            E+FA Y++IPMWPEG P +N +Q IL+WQ +TMQMMY  + + L E+ +D    PQD+L+F+CLG RE   ++V      + N+  K          + K++RFMIYVH+KGM+VDDE+V++GSANINQRS+ G++DTEIAMG YQPHH+WA+K   P GQI+GYR SLW+EHLG L+  FEEPE+++C+R+V Q++  NW ++ A E T + GHLL+YP+QVD  G VS LPGYE FPD GGKIIG
Sbjct:  609 EKFAAYIVIPMWPEGAPTSNPIQRILYWQHKTMQMMYQTIYKALVEVGLDGQLEPQDFLNFFCLGTREVGTREVPDGTVSVYNSPRKPPQLNAAQVQALKSRRFMIYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAMGGYQPHHSWAKKGSRPRGQIFGYRMSLWAEHLGFLEQEFEEPENMECVRRVRQLSELNWRQYAAEEVTEMPGHLLKYPVQVDRTGKVSSLPGYETFPDLGGKIIG 855          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDG1_ARATH (Phospholipase D gamma 1 OS=Arabidopsis thaliana GN=PLDGAMMA1 PE=1 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 2.856e-78
Identity = 135/246 (54.88%), Postives = 178/246 (72.36%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAH--PQDYLSFYCLGKRE------------EAPKDVLANNGDKVSDSQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEFTPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIG 696
            E+FA Y++IPMWPEG P +N +Q IL+WQ +TMQMMY  + + L E+ +D+   PQD+L+F+CLG RE              P    AN       + K++RFMIYVH+KGM+VDDE+V++GSANINQRS+ G++DTEIAMG YQPH++WA K   PHGQI+GYR SLW+EHLG L+  FEEPE+++C+R+V Q++  NW ++ A E T + GHLL+YP+QVD  G VS LPG E FPD GGKIIG
Sbjct:  602 EKFAAYIVIPMWPEGAPTSNPIQRILYWQHKTMQMMYQTIYKALVEVGLDSQFEPQDFLNFFCLGTREVPVGTVSVYNSPRKPPQPNANANAAQVQALKSRRFMIYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAMGGYQPHYSWAMKGSRPHGQIFGYRMSLWAEHLGFLEQGFEEPENMECVRRVRQLSELNWRQYAAEEVTEMSGHLLKYPVQVDRTGKVSSLPGCETFPDLGGKIIG 847          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDG2_ARATH (Phospholipase D gamma 2 OS=Arabidopsis thaliana GN=PLDGAMMA2 PE=1 SV=3)

HSP 1 Score: 289.656 bits (740), Expect = 1.085e-77
Identity = 133/247 (53.85%), Postives = 178/247 (72.06%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAH--PQDYLSFYCLGKREEAPKDVLANNGDKVS-------------DSQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEFTPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIG 696
            E FA Y++IPMWPEG P +  +Q IL+WQ +TMQMMY  + + L E+ +D    PQD+L+F+CLG RE   ++V     +  +              + K++RFMIYVH+KGM+VDDE+V++GSANINQRS+ G++DTEIAMG YQPHH+WA+K   P GQI+GYR SLW+EHLG L+  FEEPE+++C+R+V Q++  NWG++ A E T + GHLL+YP+QVD  G VS LPG E FPD GGKIIG
Sbjct:  599 ENFAAYIVIPMWPEGAPTSKPIQRILYWQHKTMQMMYQTIYKALLEVGLDGQLEPQDFLNFFCLGNREVGTREVPDGTVNVYNCPRKPPQPNAAQVQALKSRRFMIYVHSKGMVVDDEFVLIGSANINQRSLEGTRDTEIAMGGYQPHHSWAKKGSRPRGQIFGYRMSLWAEHLGFLEQEFEEPENMECVRRVRQLSELNWGQYAAEEVTEMSGHLLKYPVQVDKTGKVSSLPGCETFPDLGGKIIG 845          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDB1_ARATH (Phospholipase D beta 1 OS=Arabidopsis thaliana GN=PLDBETA1 PE=2 SV=3)

HSP 1 Score: 287.345 bits (734), Expect = 5.387e-77
Identity = 134/243 (55.14%), Postives = 174/243 (71.60%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDA--HPQDYLSFYCLGKREEAPKDVLANNGDKVSD---------SQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEFTPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIG 696
            ERFA Y++IPMWPEG P     Q IL+WQ +T+QMMY  + + L E  ++    PQDYL+F+CLG RE    D + N+G              S+K++RFM+YVH+KGM+VDDEYV++GSANINQRSM G++DTEIAMG+YQP HTWARK   P GQIYGYR SLW+EH+  LD+CF +PES++C+RKV  +   NW +F A E + ++GHLL+YP++VD  G V PLPG E FPD GG I+G
Sbjct:  716 ERFAAYIVIPMWPEGVPTGAATQRILYWQHKTIQMMYETIYKALVETGLEGAFSPQDYLNFFCLGNREMV--DGIDNSGTGSPRQMQTLLRPLSRKSRRFMVYVHSKGMVVDDEYVVIGSANINQRSMEGTRDTEIAMGAYQPQHTWARKHSGPRGQIYGYRMSLWAEHMANLDDCFTQPESIECVRKVRTMGERNWKQFAAEEVSDMRGHLLKYPVEVDRKGKVRPLPGSETFPDVGGNIVG 956          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDA1_ORYSJ (Phospholipase D alpha 1 OS=Oryza sativa subsp. japonica GN=PLD1 PE=1 SV=2)

HSP 1 Score: 256.529 bits (654), Expect = 1.018e-67
Identity = 124/245 (50.61%), Postives = 173/245 (70.61%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAHPQDYLSFYCLGKRE-----EAPKDVLANNGDKVSDSQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEF-TPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIGVHSMSLP 717
            ERF VYV++PMWPEG P++ +VQ IL WQ +TM+MMY+ + + L+   ++A+P+DYL+F+CLG RE     E   +         S +Q+ +RFMIYVH K MIVDDEY+I+GSANINQRSM G++D+EIAMG YQP+H   R+     GQI+G+R +LW EHLGMLD+ F+ PESL+C++KVN+IA + W  +++ +    L GHLL YP+ V +DG V+ LPG E FPD   +++G  S  +P
Sbjct:  565 ERFTVYVVVPMWPEGVPESGSVQAILDWQRRTMEMMYTDITEALQAKGIEANPKDYLTFFCLGNREVKQAGEYQPEEQPEADTDYSRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQP--ARGQIHGFRMALWYEHLGMLDDVFQRPESLECVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARVLGAKSDYMP 807          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDA1_MAIZE (Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 1.018e-67
Identity = 126/246 (51.22%), Postives = 178/246 (72.36%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAHPQDYLSFYCLGKR------EEAPKDVLANNGDKVSDSQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEF-TPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIGVHSMSLP 717
            ERF VYV++PMWPEG P++ +VQ IL WQ +TM+MMY+ +AQ L    ++A+P+DYL+F+CLG R      E  P++    + D +  +Q+ +RFMIYVH K MIVDDEY+I+GSANINQRSM G++D+EIAMG+YQP+H   R+     GQI+G+R SLW EHLGML++ F+ PES++C++KVN++A + W  +++ +    L GHLL YP+ V ADG+V+ LPG E FPD   +++G  S  LP
Sbjct:  565 ERFTVYVVVPMWPEGVPESASVQAILDWQRRTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIR-AQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQP--ARGQIHGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLGNKSDYLP 807          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDA1_VIGUN (Phospholipase D alpha 1 OS=Vigna unguiculata GN=PLD1 PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.920e-66
Identity = 129/245 (52.65%), Postives = 171/245 (69.80%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAHPQDYLSFYCLGKRE--EAPKDVLANNGDKVSDSQKNQ---RFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTATEF-TPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIGVHSMSLP 717
            ERFAVYV++PMWPEG P++++VQ IL WQ +T++MMY  V Q LR    D  P++YL+F+CLG RE  ++ +   A   +  SD Q+ Q   RFMIYVH K MIVDDEY+I+GSANINQRSM G++D+EIAMG YQP+H      +   GQ+YG+R SLW EHLGML + F+ PES +CI KVNQIA + W  +++      L GHLLRYP+ V ++G V+ LPG+E FPD   +I+G  +  LP
Sbjct:  562 ERFAVYVVVPMWPEGIPESSSVQAILDWQKRTIEMMYKDVVQALRAKGSDEDPRNYLTFFCLGNREVKKSGEYEPAEQPEPDSDYQRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYH--LANTQPARGQVYGFRMSLWYEHLGMLHDTFQRPESEECINKVNQIADKYWDLYSSESLERDLPGHLLRYPIGVASEGEVTELPGFEFFPDTKARILGAKADYLP 804          
BLAST of FC868799 vs. ExPASy Swiss-Prot
Match: PLDA1_PIMBR (Phospholipase D alpha 1 OS=Pimpinella brachycarpa GN=PLD1 PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 1.920e-66
Identity = 126/245 (51.43%), Postives = 171/245 (69.80%), Query Frame = 1
Query:    1 ERFAVYVIIPMWPEGDPKTNTVQEILFWQSQTMQMMYSVVAQELREMQVDAHPQDYLSFYCLGKRE-----EAPKDVLANNGDKVSDSQKNQRFMIYVHAKGMIVDDEYVIMGSANINQRSMAGSKDTEIAMGSYQPHHTWARKQKHPHGQIYGYRKSLWSEHLGMLDNCFEEPESLDCIRKVNQIAGENWGRFTA-TEFTPLQGHLLRYPLQVDADGTVSPLPGYEQFPDAGGKIIGVHSMSLP 717
            +RF VYV++PMWPEG P++ +VQ IL WQ +TM+MMY  + Q L+   ++  P++YL+F+CLG RE     E       +     S +Q+++RFMIYVHAK MIVDDEY+I+GSANINQRSM G+KD+EIAMG+YQPHH   R+     GQI+G+R SLW EHLGMLD+    PES+DC++KVN +A + W  +++ T    L GHLLRYP+ V ++G V+ LPG E FPD   +++G  S  LP
Sbjct:  561 KRFTVYVVLPMWPEGIPESGSVQAILDWQRRTMEMMYKDIIQALQANGIEEDPRNYLTFFCLGNREVKRDGEYEPSEKPDPDTDYSRAQESRRFMIYVHAKMMIVDDEYIIIGSANINQRSMDGAKDSEIAMGAYQPHHLATREP--ARGQIHGFRMSLWYEHLGMLDDTLALPESVDCVQKVNTVADKYWDLYSSETLENDLPGHLLRYPIAVASEGNVTELPGTEFFPDTKARVLGAKSDFLP 803          
The following BLAST results are available for this feature:
BLAST of FC868799 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
PLDD1_ARATH3.351e-10371.97Phospholipase D delta OS=Arabidopsis thaliana GN=P... [more]
PLDB2_ARATH1.515e-7955.83Phospholipase D beta 2 OS=Arabidopsis thaliana GN=... [more]
PLDG3_ARATH1.282e-7855.06Phospholipase D gamma 3 OS=Arabidopsis thaliana GN... [more]
PLDG1_ARATH2.856e-7854.88Phospholipase D gamma 1 OS=Arabidopsis thaliana GN... [more]
PLDG2_ARATH1.085e-7753.85Phospholipase D gamma 2 OS=Arabidopsis thaliana GN... [more]
PLDB1_ARATH5.387e-7755.14Phospholipase D beta 1 OS=Arabidopsis thaliana GN=... [more]
PLDA1_ORYSJ1.018e-6750.61Phospholipase D alpha 1 OS=Oryza sativa subsp. jap... [more]
PLDA1_MAIZE1.018e-6751.22Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 S... [more]
PLDA1_VIGUN1.920e-6652.65Phospholipase D alpha 1 OS=Vigna unguiculata GN=PL... [more]
PLDA1_PIMBR1.920e-6651.43Phospholipase D alpha 1 OS=Pimpinella brachycarpa ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31004H09EF AbioticL1 Citrus clementina cDNA clone C31004H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868799 ID=FC868799|Name=FC868799|organism=Citrus clementina|type=EST|length=717bp
GAGAGATTTGCAGTGTATGTCATCATACCTATGTGGCCTGAGGGTGATCC
CAAAACTAACACCGTCCAAGAAATTCTGTTTTGGCAGAGCCAGACGATGC
AGATGATGTATAGTGTTGTTGCACAGGAACTGAGGGAAATGCAAGTGGAC
GCACATCCTCAAGATTACCTCAGTTTTTATTGTCTCGGAAAACGGGAAGA
AGCTCCTAAGGATGTATTGGCCAATAATGGTGATAAGGTCTCTGATTCAC
AGAAAAATCAGCGCTTCATGATATATGTGCATGCCAAGGGGATGATAGTA
GATGATGAATATGTGATCATGGGATCTGCCAACATTAACCAAAGATCCAT
GGCTGGTTCCAAAGACACTGAGATAGCTATGGGTTCTTATCAGCCGCATC
ACACATGGGCTAGGAAGCAGAAACATCCACATGGTCAGATATATGGGTAT
AGGAAGTCACTTTGGTCAGAGCATCTTGGCATGCTAGATAATTGCTTTGA
GGAACCAGAAAGTTTAGACTGTATAAGGAAGGTAAATCAGATTGCTGGAG
AAAACTGGGGTAGATTCACAGCCACGGAGTTCACACCATTGCAGGGCCAC
CTCCTCAGATATCCTCTGCAAGTAGATGCTGATGGGACAGTGAGCCCCTT
ACCAGGTTATGAGCAATTCCCTGATGCCGGTGGTAAAATCATTGGTGTTC
ATTCCATGAGTCTTCCT
back to top