FC868800

Overview
NameFC868800
Unique NameFC868800
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9401 contig Ccv1_Contig9401:1..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868800 vs. ExPASy Swiss-Prot
Match: AOC3_ARATH (Allene oxide cyclase 3, chloroplastic OS=Arabidopsis thaliana GN=AOC3 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.268e-62
Identity = 128/210 (60.95%), Postives = 152/210 (72.38%), Query Frame = 3
Query:   81 ASASSLKPIXXXXXXXXXXXXXXETQRLLGFKSSFSSHHRNLSLSTTHQDVSRRS----SKNNVTTKAFFFNKPSSQPDSSRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGITAGLCVLIKHEPEKKGDRFEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLHQIVFP 698
            ++A SL+ I                  LLGF  SF    +NL +S+   D S RS    SKN   T+AFF+N    + ++SRP+  K+QEL VYE+NE DRNSPA+LKL +KP  L +GDLVPFTNKLYTGDL+KR+GITAGLCVLI+H PEK GDRFEA YSFYFGDYGH+SVQG YLTYEDT+LAVTGGSGIFEG YGQVKL Q+V+P
Sbjct:    5 SAAMSLESISMTTLNNLSRNHQSHRSSLLGFSRSF----QNLGISSNGPDFSSRSRSTTSKNLNVTRAFFWNW-GKKTENSRPS--KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVLIQHVPEKSGDRFEASYSFYFGDYGHLSVQGQYLTYEDTFLAVTGGSGIFEGAYGQVKLRQLVYP 207          
BLAST of FC868800 vs. ExPASy Swiss-Prot
Match: AOC4_ARATH (Allene oxide cyclase 4, chloroplastic OS=Arabidopsis thaliana GN=AOC4 PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 7.690e-60
Identity = 119/179 (66.48%), Postives = 135/179 (75.42%), Query Frame = 3
Query:  165 LGFKSSFSSHHRNLSLSTTHQDVSRRSSKNNVTTKAFFFNK-PSSQPDSSRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGITAGLCVLIKHEPEKKGDRFEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLHQIVFP 698
            LGF  SF     N  +S+    +S R+     +T  FF     SS  D SRP   K+QEL VYE NE DRNSPA+LKL +KP+ L +GDLVPFTNKLYTGDL KRIGITAGLCVLI+H PEKKGDRFEA YSFYFGDYGHISVQG YLTYEDT+LA+TGGSG+FEG YGQVKL Q+V+P
Sbjct:   31 LGFSRSF----HNQRISSNSPGLSTRARSTTSSTGGFFRTICSSSSNDYSRPT--KIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVLIQHVPEKKGDRFEASYSFYFGDYGHISVQGPYLTYEDTFLAITGGSGVFEGAYGQVKLRQLVYP 203          
BLAST of FC868800 vs. ExPASy Swiss-Prot
Match: AOC2_ARATH (Allene oxide cyclase 2, chloroplastic OS=Arabidopsis thaliana GN=AOC2 PE=1 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 2.649e-52
Identity = 115/209 (55.02%), Postives = 138/209 (66.03%), Query Frame = 3
Query:   81 ASASSLKPIXXXXXXXXXXXXXXETQRLLGFKSSFSSHHRNLSLSTTHQDVSRRSS---KNNVTTKAFFFNKPSSQPDSSRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGITAGLCVLIKHEPEKKGDRFEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLHQIVFP 698
            +SA SL+ I                  LLG   SF    +NL +S+   D S  SS   K N+T         S   +   P  +KVQEL VYEINE DR+SP ILK +       +GDLVPFTNKLYTGDL+KR+GITAGLCV+I+H PEKKG+RFEA YSFYFGDYGH+SVQG YLTYED++LA+TGG+GIFEG YGQVKL Q+V+P
Sbjct:    3 SSAVSLQSISMTTLNNLSCNQQFHRSSLLGSSKSF----QNLGISSNGSDFSYPSSFTAKKNLTASRAL----SQNGNIENPRPSKVQELSVYEINELDRHSPKILK-NAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKKGERFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYP 202          
BLAST of FC868800 vs. ExPASy Swiss-Prot
Match: AOC1_ARATH (Allene oxide cyclase 1, chloroplastic OS=Arabidopsis thaliana GN=AOC1 PE=1 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 8.522e-51
Identity = 104/179 (58.10%), Postives = 128/179 (71.51%), Query Frame = 3
Query:  162 LLGFKSSFSSHHRNLSLSTTHQDVSRRSSKNNVTTKAFFFNKPSSQPDSSRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGITAGLCVLIKHEPEKKGDRFEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLHQIVFP 698
            LLGF  SF +   + +   +    S    K    T+A   N  +++     P  +KVQEL VYEIN+ DR+SP ILK +       +GDLVPFTNKLYTGDL+KR+GITAGLCV+I+H PEK GDRFEA YSFYFGDYGH+SVQG YLTYED++LA+TGG+GIFEG YGQVKL Q+V+P
Sbjct:   30 LLGFSKSFQNFGISSNGPGSSSPTSFTPKKKLTPTRALSQNLGNTE----NPRPSKVQELSVYEINDLDRHSPKILK-NAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVIEHVPEKNGDRFEATYSFYFGDYGHLSVQGPYLTYEDSFLAITGGAGIFEGAYGQVKLQQLVYP 203          
The following BLAST results are available for this feature:
BLAST of FC868800 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
AOC3_ARATH1.268e-6260.95Allene oxide cyclase 3, chloroplastic OS=Arabidops... [more]
AOC4_ARATH7.690e-6066.48Allene oxide cyclase 4, chloroplastic OS=Arabidops... [more]
AOC2_ARATH2.649e-5255.02Allene oxide cyclase 2, chloroplastic OS=Arabidops... [more]
AOC1_ARATH8.522e-5158.10Allene oxide cyclase 1, chloroplastic OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31004H10EF AbioticL1 Citrus clementina cDNA clone C31004H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868800 ID=FC868800|Name=FC868800|organism=Citrus clementina|type=EST|length=715bp
GACTACGCTCCATTTCATTTCTTCAATCATCGCCATCCAGATAACTTTAC
TCATTCAATATTTTCTGCAAATCAATAATGGCCTCTGCAAGCTCTCTCAA
GCCCATCTCTTATTCTCTGAACCTCCCTAACTCGAGATCCTCTTCTTCCG
AAACCCAAAGGTTGCTAGGTTTCAAATCATCTTTTTCCTCTCATCATCGA
AACCTCAGTCTCTCAACAACCCACCAAGATGTCTCAAGAAGAAGCTCCAA
GAACAACGTCACCACCAAAGCTTTCTTCTTCAACAAACCCAGCAGCCAAC
CAGATTCTTCCAGGCCTGCTAATAATAAGGTTCAAGAACTGTTCGTGTAT
GAGATCAACGAGCGGGACAGAAACAGCCCGGCAATTCTGAAGCTAAGCCA
AAAGCCTGAACATCTCACAATCGGCGACCTTGTGCCCTTCACGAACAAGC
TCTACACCGGCGACTTACAGAAGCGCATTGGCATCACGGCGGGGCTCTGC
GTGTTGATCAAGCACGAACCGGAGAAGAAGGGTGACCGGTTTGAAGCGAT
TTACAGCTTCTACTTCGGTGACTACGGTCACATATCCGTGCAGGGAGCTT
ATTTGACTTACGAAGACACGTACTTGGCCGTCACCGGTGGCTCCGGGATC
TTTGAGGGCGTGTACGGACAAGTCAAGTTGCATCAAATTGTTTTCCCTTA
CAGTTGTTTACACTT
back to top