FC868802

Overview
NameFC868802
Unique NameFC868802
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length716
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10229 contig Ccv1_Contig10229:36..751. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10AL_ARATH (FAM10 family protein At4g22670 OS=Arabidopsis thaliana GN=At4g22670 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.578e-51
Identity = 99/146 (67.81%), Postives = 115/146 (78.77%), Query Frame = 3
Query:  171 DVMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRIQ 608
            D +EPDNDP QKMGD SVEVT+E R+AA   K KA++ +SEG  ++AI  LT AI LNPTSAI+Y  RA VY+KL KPNAAIRDA  ALE NPDSAKGYK RGMARA LG+W EAA DLH+AS +DYDEEI   LKKVEPNA +++
Sbjct:   96 DTVEPDNDPPQKMGDSSVEVTDENREAAQEAKGKAMEALSEGNFDEAIEHLTRAITLNPTSAIMYGNRASVYIKLKKPNAAIRDANAALEINPDSAKGYKSRGMARAMLGEWAEAAKDLHLASTIDYDEEISAVLKKVEPNAHKLE 241          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10A1_CHICK (Hsc70-interacting protein OS=Gallus gallus GN=ST13 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.243e-41
Identity = 86/147 (58.50%), Postives = 108/147 (73.47%), Query Frame = 3
Query:  165 NTDVMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            N  V+EPDND  Q+MGD +VEVTEEM D AN  K++A++ +SEG L+ A+   T+AI LNP  AILYA RA V+VKL KPNAAIRD   A++ NPDSA+ YK RG A   LG WEEAA+DL +A KLDYDE+    LK+V+P A++I
Sbjct:   83 NEGVIEPDNDDPQEMGDENVEVTEEMMDQANEKKMEAINALSEGDLQKAVNLFTDAIKLNPCLAILYAKRASVFVKLQKPNAAIRDCDRAIKINPDSAQTYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKI 229          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10A5_HUMAN (Protein FAM10A5 OS=Homo sapiens GN=FAM10A5 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.520e-39
Identity = 82/144 (56.94%), Postives = 106/144 (73.61%), Query Frame = 3
Query:  174 VMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            V+EPD D  Q+MGD +VE+TEEM D AN  K+ A++++++G+L+ AI   T+AI LNP  AILYA RA V+VKL KPNAAI+D   A+E NPDSA+ YK RG A   LG WEEAA+DL  A KLDYDE+    LK+V+P A++I
Sbjct:   88 VIEPDTDAPQEMGDENVEITEEMMDQANDKKVAAIEVLNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIQDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLAFACKLDYDEDASAMLKEVQPRAQKI 231          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10A1_PONAB (Hsc70-interacting protein OS=Pongo abelii GN=ST13 PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.520e-39
Identity = 82/144 (56.94%), Postives = 105/144 (72.92%), Query Frame = 3
Query:  174 VMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            V+EPD D  Q+MGD + E+TEEM D AN  K+ A++ +++G+L+ AI   T+AI LNP  AILYA RA V+VKL KPNAAIRD   A+E NPDSA+ YK RG A   LG WEEAA+DL +A KLDYDE+    LK+V+P A++I
Sbjct:   88 VIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPKAQKI 231          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10A1_HUMAN (Hsc70-interacting protein OS=Homo sapiens GN=ST13 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.520e-39
Identity = 82/144 (56.94%), Postives = 105/144 (72.92%), Query Frame = 3
Query:  174 VMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            V+EPD D  Q+MGD + E+TEEM D AN  K+ A++ +++G+L+ AI   T+AI LNP  AILYA RA V+VKL KPNAAIRD   A+E NPDSA+ YK RG A   LG WEEAA+DL +A KLDYDE+    LK+V+P A++I
Sbjct:   88 VIEPDTDAPQEMGDENAEITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKI 231          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10A1_MOUSE (Hsc70-interacting protein OS=Mus musculus GN=St13 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.386e-39
Identity = 82/147 (55.78%), Postives = 105/147 (71.43%), Query Frame = 3
Query:  165 NTDVMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            N  V+EPD D  Q+MGD + E+TEEM D AN  K  A++ +++G+L+ AI   T+AI LNP  AILYA RA V+VKL KPNAAIRD   A+E NPDSA+ YK RG A   LG WEEAA+DL +A KLDYDE+    L++V+P A++I
Sbjct:   84 NEGVIEPDTDAPQEMGDENAEITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLREVQPRAQKI 230          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10A4_HUMAN (Protein FAM10A4 OS=Homo sapiens GN=FAM10A4 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.287e-38
Identity = 80/144 (55.56%), Postives = 104/144 (72.22%), Query Frame = 3
Query:  174 VMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            V+EPD D  Q+MGD + E+TEE+ D AN  K+ A++ +++G+L+ AI   T+AI LNP  AILYA RA V+VKL KPNAAIRD   A+E NPDSA+ YK RG A   LG WEEAA+DL +A K DYDE+    LK+V+P A++I
Sbjct:   84 VIEPDTDAPQEMGDENAEITEEVMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKRRGKAHRLLGHWEEAAHDLALACKFDYDEDASAMLKEVQPRAQKI 227          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: F10A1_RAT (Hsc70-interacting protein OS=Rattus norvegicus GN=St13 PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.386e-38
Identity = 81/147 (55.10%), Postives = 102/147 (69.39%), Query Frame = 3
Query:  165 NTDVMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            N  V+E D D  Q+MGD + E+TE M D AN  K  A+D +++G+L+ AI   T+AI LNP  AILYA RA V+VKL KPNAAIRD   A+E NPDSA+ YK RG A   LG WEEAA DL +A KLDYDE+    L++V+P A++I
Sbjct:   84 NEGVIEADTDAPQEMGDENAEITEAMMDEANEKKGAAIDALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAARDLALACKLDYDEDASAMLREVQPRAQKI 230          
BLAST of FC868802 vs. ExPASy Swiss-Prot
Match: HRP_PLABE (58 kDa phosphoprotein OS=Plasmodium berghei PE=1 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 8.116e-17
Identity = 47/127 (37.01%), Postives = 69/127 (54.33%), Query Frame = 3
Query:  225 EVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRI 605
            E++EE  +     K +AVDL+   K E+A+ +  + I     SA++Y  RA + + L +P A IRD   AL  N DSA  YKIR  A   LG+WE A  D+    K+DYDE +    K ++   ++I
Sbjct:  104 ELSEEQIEEICKLKEEAVDLVENKKYEEALEKYNKIISFGNPSAMIYTKRASILLNLKRPKACIRDCTEALNLNVDSANAYKIRAKAYRYLGKWEFAHADMEQGQKIDYDENLWDMQKLIQEKYKKI 230          
The following BLAST results are available for this feature:
BLAST of FC868802 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
F10AL_ARATH6.578e-5167.81FAM10 family protein At4g22670 OS=Arabidopsis thal... [more]
F10A1_CHICK1.243e-4158.50Hsc70-interacting protein OS=Gallus gallus GN=ST13... [more]
F10A5_HUMAN1.520e-3956.94Protein FAM10A5 OS=Homo sapiens GN=FAM10A5 PE=1 SV... [more]
F10A1_PONAB1.520e-3956.94Hsc70-interacting protein OS=Pongo abelii GN=ST13 ... [more]
F10A1_HUMAN1.520e-3956.94Hsc70-interacting protein OS=Homo sapiens GN=ST13 ... [more]
F10A1_MOUSE3.386e-3955.78Hsc70-interacting protein OS=Mus musculus GN=St13 ... [more]
F10A4_HUMAN1.287e-3855.56Protein FAM10A4 OS=Homo sapiens GN=FAM10A4 PE=1 SV... [more]
F10A1_RAT6.386e-3855.10Hsc70-interacting protein OS=Rattus norvegicus GN=... [more]
HRP_PLABE8.116e-1737.0158 kDa phosphoprotein OS=Plasmodium berghei PE=1 S... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31004H12EF AbioticL1 Citrus clementina cDNA clone C31004H12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868802 ID=FC868802|Name=FC868802|organism=Citrus clementina|type=EST|length=716bp
GACTGCAAATCAAAATCAATACCCTTTTTCAAGTCCTATCTTCATAGAAA
GAGGATAAAAGTGGTGTTGACATGTCCGACTCTGTTAAGCATTTTGAAGC
AATGAAGTCCAATTTATCAACTGAAGATGATGACGACATTGTGGAGTCTG
ATATTGAGTTGGATAATACTGATGTTATGGAGCCCGACAATGATCCTTCA
CAAAAGATGGGAGACCCGTCAGTTGAAGTTACAGAAGAAATGCGTGATGC
AGCAAATATGACAAAACTAAAAGCAGTAGATTTGATCTCTGAAGGCAAGT
TGGAGGATGCCATAGGACAACTAACAGAAGCCATAATGTTGAATCCTACT
TCAGCAATACTTTATGCAGCTCGAGCTGGTGTCTATGTTAAACTAAACAA
ACCTAATGCTGCAATCCGCGATGCTTATGTAGCTTTAGAGACTAACCCTG
ACTCAGCAAAAGGATATAAAATACGTGGGATGGCAAGGGCCAGGTTGGGC
CAGTGGGAAGAAGCTGCAAATGATTTGCATGTGGCATCAAAGTTAGACTA
CGATGAGGAGATTGGCATGGCACTCAAGAAGGTTGAACCTAATGCTCGTA
GAATTCAAGAACATCGAAGAAAATATGAACGGCTGCGTAAAGAAAGGGAG
CTAAAAAATTTTGAACGTGAGAGGCAAAGAAAACAAGCTGGAGCCGATCG
AGAAGCTTTGTCTGGT
back to top