FC868808

Overview
NameFC868808
Unique NameFC868808
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length600
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12687 contig Ccv1_Contig12687:157..756. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868808 vs. ExPASy Swiss-Prot
Match: ACY1_MOUSE (Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.095e-31
Identity = 68/126 (53.97%), Postives = 83/126 (65.87%), Query Frame = 3
Query:  210 KSDDSIIERFRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQLPSILLNSHTDVVPSEPSKWSHHPFGAHLDSQGNIFARGSQDMKCVGMQYLEAIRRLKASG 587
            +S+   +  FR YL+I T QPNPDY  A  F+  +A  L L  Q +E      + +L WPG+NP LPSILLNSHTDVVP     W H PF A  DS+G I+ARGSQDMK V +QYLEA+RRLK+ G
Sbjct:    7 ESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEG 132          
BLAST of FC868808 vs. ExPASy Swiss-Prot
Match: ACY1A_RAT (Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 9.269e-31
Identity = 67/126 (53.17%), Postives = 84/126 (66.67%), Query Frame = 3
Query:  210 KSDDSIIERFRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQLPSILLNSHTDVVPSEPSKWSHHPFGAHLDSQGNIFARGSQDMKCVGMQYLEAIRRLKASG 587
            +S+   +  FR YL+I T QPNPDY +A  F+  +A  L L  Q +E A    + +L WPG+NP L SILLNSHTDVVP     W H PF A  DS+G I+ARG+QDMK V +QYLEA+RRLK+ G
Sbjct:    7 ESEHPSVTLFRQYLRICTVQPNPDYGSAVTFLEERARQLGLSCQKIEVAPGYVITVLTWPGTNPLLHSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGAQDMKSVSIQYLEAVRRLKSEG 132          
BLAST of FC868808 vs. ExPASy Swiss-Prot
Match: ACY1_PONAB (Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.581e-30
Identity = 66/117 (56.41%), Postives = 78/117 (66.67%), Query Frame = 3
Query:  237 FRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQLPSILLNSHTDVVPSEPSKWSHHPFGAHLDSQGNIFARGSQDMKCVGMQYLEAIRRLKASG 587
            FR YL+I T QP PDY  A  F   +A  L L  Q +E A    + +L WPG+NP L SILLNSHTDVVP     WSH PF A  DS+G I+ARG+QDMKC+ +QYLEA+RRLK  G
Sbjct:   16 FRQYLRIRTVQPKPDYGAAVAFFEERARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCISIQYLEAVRRLKVEG 132          
BLAST of FC868808 vs. ExPASy Swiss-Prot
Match: ACY1_HUMAN (Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.065e-30
Identity = 67/117 (57.26%), Postives = 77/117 (65.81%), Query Frame = 3
Query:  237 FRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQLPSILLNSHTDVVPSEPSKWSHHPFGAHLDSQGNIFARGSQDMKCVGMQYLEAIRRLKASG 587
            FR YL+I T QP PDY  A  F    A  L L  Q +E A    + +L WPG+NP L SILLNSHTDVVP     WSH PF A  DS+G I+ARG+QDMKCV +QYLEA+RRLK  G
Sbjct:   16 FRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEG 132          
BLAST of FC868808 vs. ExPASy Swiss-Prot
Match: ACY1B_RAT (Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.338e-29
Identity = 65/117 (55.56%), Postives = 76/117 (64.96%), Query Frame = 3
Query:  237 FRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQLPSILLNSHTDVVPSEPSKWSHHPFGAHLDSQGNIFARGSQDMKCVGMQYLEAIRRLKASG 587
            FR YL+I T QP PDY  A  F    A  L L  Q +E A    + +L WPG+NP L SILLNSHTDVVP     WSH PF A  DS+G I+ RG+QDMKCV +QYLEA++RLK  G
Sbjct:   16 FRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYTRGAQDMKCVSIQYLEAVKRLKVEG 132          
BLAST of FC868808 vs. ExPASy Swiss-Prot
Match: ACY1_PIG (Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 5.086e-29
Identity = 63/117 (53.85%), Postives = 75/117 (64.10%), Query Frame = 3
Query:  237 FRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQLPSILLNSHTDVVPSEPSKWSHHPFGAHLDSQGNIFARGSQDMKCVGMQYLEAIRRLKASG 587
            FR YL+I T QP PDY  A  F+  +A  L L  Q +E      + +L WPG+NP L SILLNSHTDVVP     WSH PF    D+ G I+ RG+QDMKCV +QYLEA+RRLK  G
Sbjct:   16 FRQYLRIRTVQPEPDYGAAVAFLEERARQLGLGCQKVEVVPGHVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEGFKDADGYIYGRGAQDMKCVSIQYLEAVRRLKVEG 132          
BLAST of FC868808 vs. ExPASy Swiss-Prot
Match: ACY1_DICDI (Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.193e-23
Identity = 52/117 (44.44%), Postives = 73/117 (62.39%), Query Frame = 3
Query:  237 FRAYLQIDTSQPNPDYTNASKFILAQAEALSLESQTLEFAKNKPLILLKWPGSNPQLPSILLNSHTDVVPSEPSKWSHHPFGAHLDSQGNIFARGSQDMKCVGMQYLEAIRRLKASG 587
            FR +L+I T  P PDY +++KF++ +A+  ++  +        P++L+K  G  P L ++LLNSH DVVP+    W   PF A  D  GNIF RG+QDMKCV MQ+LE  RR+  SG
Sbjct:   13 FREFLKIRTDHPTPDYESSTKFLVEKAKEYNIPYEVYR-ETGTPIVLMKIEGLEPNLKTVLLNSHVDVVPAVHDSWKVDPFSAWKDESGNIFGRGTQDMKCVCMQFLEVARRIVQSG 128          
The following BLAST results are available for this feature:
BLAST of FC868808 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
ACY1_MOUSE1.095e-3153.97Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1[more]
ACY1A_RAT9.269e-3153.17Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1... [more]
ACY1_PONAB1.581e-3056.41Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2[more]
ACY1_HUMAN2.065e-3057.26Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1[more]
ACY1B_RAT1.338e-2955.56Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1... [more]
ACY1_PIG5.086e-2953.85Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2[more]
ACY1_DICDI3.193e-2344.44Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31005A08EF AbioticL1 Citrus clementina cDNA clone C31005A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868808 ID=FC868808|Name=FC868808|organism=Citrus clementina|type=EST|length=600bp
TTAGTTGTTTTTTCGATTCCATTTGATAAACAAGTGCAGCCCTGGGCGCT
TTAACTGTGTTGAGGAGGACCAACCGTTAATCCGCTAATCGCTGACCTGA
CGTTGTCACACACACTCACAGTCTCCTTGGAAACAAAATGAGGAATCGGC
ATCGTCTTCTTCATATCTGCTTCGTATTGTATCAACTGATCATCTTCTCA
AGCCCAGCAAAATCAGATGATTCTATAATAGAAAGATTCCGAGCATACCT
CCAAATCGACACGTCTCAACCAAACCCGGACTACACAAATGCCTCCAAGT
TTATCCTGGCTCAGGCCGAAGCCCTCTCCCTCGAATCCCAAACCCTCGAA
TTCGCCAAAAACAAGCCCCTCATTCTTCTCAAGTGGCCCGGCTCGAACCC
TCAACTACCCTCCATCCTCCTCAACTCCCACACCGACGTCGTTCCATCTG
AACCCAGCAAATGGTCCCACCATCCCTTCGGTGCCCACCTCGATTCTCAG
GGGAATATCTTCGCCAGAGGGTCCCAGGACATGAAGTGCGTGGGCATGCA
GTACTTGGAGGCCATACGAAGATTGAAGGCNAGTGGGTTTCAGCCTGTTC
back to top