FC868810

Overview
NameFC868810
Unique NameFC868810
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length733
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868810_ssr150 microsatellite FC868810_ssr150:150..161. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9403 contig Ccv1_Contig9403:1..733. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868810 vs. ExPASy Swiss-Prot
Match: Y2168_ARATH (Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.481e-61
Identity = 112/169 (66.27%), Postives = 140/169 (82.84%), Query Frame = 1
Query:  232 RFITHQSFFSAVRSGDLETIKNIIDNLTKDEAPDGSS---LVSELMAMQNDTGETALYISAANNFQDIFSCLLKFCDVEIVKIRSRSDMNTFHVAAKKGHLGIAKELVSIWPELCKSCDSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYGLI 729
            +F+THQ+FFS+VRSGDL  ++ ++DNLT DE  D SS    V+ELM++QND GETA+YISAA N +DIF  L++F  +E VKIRS+SDMN FHVAAK+GHLGI KEL+ +WPELC+ CD+SNTSPLY+AAVQDHL++VN +LD D SC  IVRKNGKT+LHTA RYGL+
Sbjct:    7 KFLTHQAFFSSVRSGDLSQLQQLVDNLTGDELIDESSPCSAVAELMSVQNDAGETAVYISAAENLEDIFRYLIRFSSLETVKIRSKSDMNAFHVAAKRGHLGIVKELLRLWPELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCAMIVRKNGKTSLHTAGRYGLL 175          
BLAST of FC868810 vs. ExPASy Swiss-Prot
Match: Y5262_ARATH (Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.019e-22
Identity = 61/155 (39.35%), Postives = 90/155 (58.06%), Query Frame = 1
Query:  259 SAVRSGDLETIKNIIDNLTKDEAPDGSSLVSELMAMQNDTGETALYISAANNFQDIFSCLLKFCDVEIVKIRSRSDMNTFHVAAKKGHLGIAKELVSIWPELCKSCDSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYG 723
            +AVR G  + +  +I         DG  L  EL+A QN +GETALY++A   + D+   L+K  D  +   ++++  + FH+AAK G+L +   L+   PEL  + DSS T+ L++AA Q H ++V  +LD  V    I R NGKTALH+AAR G
Sbjct:   23 TAVREGKTDLLLEMIGE------HDGVEL-KELLAEQNQSGETALYVAAEYGYTDMVKILMKHSDSVLAGTKAKNGFDAFHIAAKNGNLQVLDVLIEANPELSFTFDSSKTTALHTAASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSAARNG 170          
BLAST of FC868810 vs. ExPASy Swiss-Prot
Match: Y3236_ARATH (Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.096e-15
Identity = 53/163 (32.52%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  262 AVRSGDLETIKNIIDNLTKD-----EAPDGSSLVSELMAM----QNDTGETALYISAANNFQDIFSCLLKFCDVEIVKIRSRSDMNTFHVAAKKGHLGIAKELVSIWPELCKSCDSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYG 723
            A + GDL  ++ I+ ++           +  + V+E+ A      N+ GETAL+ +A     D+   LLK+   E +  ++RS  +  H+AA +GH  I + L+     L ++   SN +PL SAA++ H +VVN +L    +   I R N K ALH AAR G
Sbjct:   81 AAQRGDLAAVQQILKDINSQMEGILSGEEFDAEVAEIRASIVNEVNELGETALFTAADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIVEVLLDHDATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAARQG 243          
The following BLAST results are available for this feature:
BLAST of FC868810 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
Y2168_ARATH1.481e-6166.27Ankyrin repeat-containing protein At2g01680 OS=Ara... [more]
Y5262_ARATH3.019e-2239.35Ankyrin repeat-containing protein At5g02620 OS=Ara... [more]
Y3236_ARATH2.096e-1532.52Ankyrin repeat-containing protein At3g12360 OS=Ara... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31005A10EF AbioticL1 Citrus clementina cDNA clone C31005A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868810 ID=FC868810|Name=FC868810|organism=Citrus clementina|type=EST|length=733bp
CTTGCCGGGGACTCAATCAATCCACCAATTAGTCATATCCAAGAAGAGAG
AAACGATACATGTGTCCCTTTATATCATCAAATCCTTCTCGCATCTTATT
AAGTCTTCTCTTCATTGACAAAGAAGAAAGAAAACACAAAGTGTACTATA
GAAGAAGAAGATCATTTTTATTATGCTTGTAAATTGGATTTCAGTTCTTC
AAGTCTTCTGATGGATTCATTAAAGTCATTCAGGTTCATTACCCACCAAT
CTTTTTTCTCTGCCGTTCGATCTGGGGACCTGGAAACCATCAAGAATATT
ATTGATAATTTGACAAAGGATGAAGCTCCTGATGGTTCTTCTTTGGTATC
TGAGCTAATGGCTATGCAGAATGATACAGGGGAGACTGCCCTGTACATCT
CTGCAGCTAATAATTTTCAGGATATTTTCAGTTGCTTGCTTAAGTTTTGT
GATGTTGAGATTGTCAAAATCAGGTCCCGGTCTGATATGAACACGTTTCA
TGTTGCCGCTAAGAAAGGCCACTTGGGGATCGCAAAGGAGCTTGTGAGCA
TTTGGCCTGAGCTATGTAAGTCCTGTGACTCCTCAAATACTAGCCCACTT
TATTCGGCAGCTGTACAAGATCATTTGGATGTGGTGAATACCATCTTGGA
TGCTGATGTCAGCTGCACGAGAATAGTTAGAAAAAATGGAAAAACAGCGC
TGCATACTGCTGCGAGGTATGGTCTCATTAATA
back to top