FC868811

Overview
NameFC868811
Unique NameFC868811
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length670
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10228 contig Ccv1_Contig10228:34..703. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_SOLTU (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum tuberosum GN=PSBO PE=2 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.257e-87
Identity = 164/199 (82.41%), Postives = 174/199 (87.44%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MAASLQAAATLMQPTKVG V A            VSKAFG++ + +R+SCSL  DLKD AQKC DA KIAGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAA
Sbjct:    1 MAASLQAAATLMQPTKVGGVSARNNLQLRSSQS-VSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAA 198          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_TOBAC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Nicotiana tabacum GN=PSBO PE=2 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 2.948e-87
Identity = 165/199 (82.91%), Postives = 173/199 (86.93%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MAASLQAAATLMQPTKVGV PA            VSKAFGV+ A AR++CSL  +LKDLAQK  DA K+AGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGV SFAFKPGKY AKKFCLEPTSFTVKAE VNKNAPPDFQ TKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAA
Sbjct:    1 MAASLQAAATLMQPTKVGVAPARNNLQLRSAQS-VSKAFGVEPAAARLTCSLQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAA 198          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_SOLLC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum lycopersicum GN=PSBO PE=2 SV=2)

HSP 1 Score: 314.694 bits (805), Expect = 2.759e-85
Identity = 160/199 (80.40%), Postives = 171/199 (85.93%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MAASLQAAATLMQPTKVGV               VSKAFGV+    R++CSL  ++K+LAQKC DA KIAGFALATSALVVSGA+AEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTI+GGV SFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAA
Sbjct:    1 MAASLQAAATLMQPTKVGV----RNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAA 195          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_PEA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Pisum sativum GN=PSBO PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.200e-80
Identity = 152/199 (76.38%), Postives = 168/199 (84.42%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MAASLQAAATLMQPTK+                 VSKAFG++  GA+++CSL +D K+LA KCV+A+KIAGFALATSALVVSGASAEG PKRLT+DEIQSKTY+EVKGTGTANQCPTIDGGVDSF+FKPGKY AKK CLEPTSFTVK+EGV KN P  FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAA
Sbjct:    1 MAASLQAAATLMQPTKL-----RSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVEASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAA 194          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO2_ARATH (Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana GN=PSBO2 PE=1 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 8.597e-79
Identity = 146/199 (73.37%), Postives = 164/199 (82.41%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MA SLQAAAT +QP K+   P+            V K+FG+DS+ AR++CSL++DLKD A KC DA KIAGFALATSALVVSGA AEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FK GKY  KKFC EPTSFTVKA+ V+KNAPPDFQNTKLMTRLTYTLDEIEGPFEV  DG++KF E+DGIDYAA
Sbjct:    1 MATSLQAAATFLQPAKIAASPSRNVHLRSNQT--VGKSFGLDSSQARLTCSLHSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAA 197          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_FRIAG (Oxygen-evolving enhancer protein 1, chloroplastic OS=Fritillaria agrestis GN=PSBO PE=2 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 2.501e-78
Identity = 149/200 (74.50%), Postives = 171/200 (85.50%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGA-RISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MA+SLQAAATL+ P KVG  PA            +SKAFG D++ A R++CS+N+DL+D+AQKC DA K+AGFALATSALV+SGASAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG +SF +K GKY  KK CLEPTSFTVKAEG+NKNAPP+FQ TKLMTRLTYTLDEIEGPFEV+PDGT+KF EKDGIDYAA
Sbjct:    1 MASSLQAAATLI-PAKVGA-PARTHLRSNSH---LSKAFGFDNSTAGRLTCSINSDLRDIAQKCTDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTESFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAA 195          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_SPIOL (Oxygen-evolving enhancer protein 1, chloroplastic OS=Spinacia oleracea GN=PSBO PE=1 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 2.765e-77
Identity = 150/201 (74.63%), Postives = 166/201 (82.59%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSA--GARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MAASLQA+ T +QPTKV    A            V KAFGV+SA  G R+S SL +DLK+LA KCVDATK+AG ALATSAL+ SGA+AEG  KRLTYDEIQSKTY+EVKGTGTANQCPT++GGVDSFAFKPGKY AKKFCLEPT F VKAEG++KN+ PDFQNTKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAA
Sbjct:    1 MAASLQASTTFLQPTKV----ASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANKCVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAA 196          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO1_ARATH (Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana GN=PSBO1 PE=1 SV=2)

HSP 1 Score: 284.263 bits (726), Expect = 3.993e-76
Identity = 139/199 (69.85%), Postives = 161/199 (80.90%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MAASLQ+ AT +Q  K+   P+            V K+FG++++ AR++CS  +D KD   KC DA KIAGFALATSALVVSGASAEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FKPGKY  KKFC EPTSFTVKA+ V+KNAPP+FQNTKLMTRLTYTLDEIEGPFEV+ DG++ F E+DGIDYAA
Sbjct:    1 MAASLQSTATFLQSAKIATAPSRGSSHLRSTQA-VGKSFGLETSSARLTCSFQSDFKDFTGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAA 198          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_WHEAT (Oxygen-evolving enhancer protein 1, chloroplastic OS=Triticum aestivum GN=PSBO PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 4.882e-74
Identity = 144/199 (72.36%), Postives = 162/199 (81.41%), Query Frame = 3
Query:   72 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            MAASLQAAAT+M P K+G                V++AFGVD AGARI+CSL +D++++A KC DA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSF FK GKY+ KKFCLEPTSFTVKAEG+ KN PP FQ TKLMTRLTYTLDE+EGP EV    T+KF EKDGIDYAA
Sbjct:    1 MAASLQAAATVM-PAKIG-----GRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCADAAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRRTLKFEEKDGIDYAA 192          
BLAST of FC868811 vs. ExPASy Swiss-Prot
Match: PSBO_VOLCA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Volvox carteri GN=PSBO PE=2 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 9.638e-30
Identity = 65/129 (50.39%), Postives = 82/129 (63.57%), Query Frame = 3
Query:  285 FALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID-GGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAA 668
            F  A +A+V + A   G    LTYDE+Q  TY++VKGTG AN CP ++ G  D      G Y+ + FC+EPTSFTVK E V K    +F  TKLMTRLTYTLD + G  +V  DG+ +  E+DGIDYAA
Sbjct:   32 FGQAAAAVVAASALVAGSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTVKEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAA 160          
The following BLAST results are available for this feature:
BLAST of FC868811 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
PSBO_SOLTU2.257e-8782.41Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_TOBAC2.948e-8782.91Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLLC2.759e-8580.40Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_PEA1.200e-8076.38Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO2_ARATH8.597e-7973.37Oxygen-evolving enhancer protein 1-2, chloroplasti... [more]
PSBO_FRIAG2.501e-7874.50Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SPIOL2.765e-7774.63Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO1_ARATH3.993e-7669.85Oxygen-evolving enhancer protein 1-1, chloroplasti... [more]
PSBO_WHEAT4.882e-7472.36Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_VOLCA9.638e-3050.39Oxygen-evolving enhancer protein 1, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005A11EF AbioticL1 Citrus clementina cDNA clone C31005A11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868811 ID=FC868811|Name=FC868811|organism=Citrus clementina|type=EST|length=670bp
CTCGCCGGGGAGTTTGTTTCTTAGAAGATAAAGCGATACTAGCAAGTAAC
CCACAAGTGGTAGGGAGCAAGATGGCAGCCTCGTTACAAGCCGCAGCTAC
ACTGATGCAACCCACCAAGGTGGGTGTGGTACCCGCTCGCAGCAGCAGCC
TGCAGCTGAGGTCTTCACAGAGCGTTTCGAAGGCTTTTGGTGTCGACTCA
GCTGGTGCTAGGATCTCTTGCTCTTTGAATAATGACTTGAAGGATTTGGC
TCAGAAATGTGTTGATGCTACCAAGATCGCTGGCTTTGCCCTCGCCACTT
CTGCTCTCGTCGTTTCGGGAGCAAGTGCTGAAGGTGTTCCAAAGAGGCTA
ACCTATGATGAAATCCAGAGCAAGACATACATGGAAGTGAAGGGAACCGG
AACTGCTAACCAGTGCCCAACCATTGATGGCGGAGTTGACTCTTTTGCCT
TCAAACCTGGCAAATACCAGGCTAAGAAGTTCTGCCTAGAACCAACTTCC
TTCACTGTCAAGGCTGAGGGTGTCAACAAGAATGCCCCACCAGATTTCCA
GAACACCAAGCTCATGACCCGCCTTACCTACACCCTTGACGAGATTGAGG
GACCTTTTGAAGTGTCCCCCGATGGCACCATTAAGTTTGTGGAGAAGGAT
GGAATTGACTATGCTGCTGT
back to top