FC868812

Overview
NameFC868812
Unique NameFC868812
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length534
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15504 contig Ccv1_Contig15504:106..639. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 9.184e-58
Identity = 107/179 (59.78%), Postives = 137/179 (76.54%), Query Frame = 1
Query:    1 PCVQELVKNPALFA-PDRYIRPDQDSPLISDDILIS-QIPVIDMQSLLSKESMDSELAKLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYWQRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKMGEVL 531
            P VQE+VK   +   P RY+R DQD   + DD  +  +IP+IDM+ L S  +MDSE+ KLDFACKEWGFFQLVNHG+ ++FL+++K E++ FFN  MEEKKK+WQRP ++EGFGQAFVVSE+QKLDWADLF     PV LRKPHLFPKLP   R+TLE+YS E++++A+ LI+KM   L
Sbjct:   15 PSVQEMVKEKTITTVPPRYVRSDQDKTEVDDDFDVKIEIPIIDMKRLCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQRPDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQSVAKILIAKMARAL 193          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: NCS1_COPJA (S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.685e-35
Identity = 81/177 (45.76%), Postives = 107/177 (60.45%), Query Frame = 1
Query:    7 VQELVKNPALFAPDRYIRPD--QDSPLISDDILISQIPVIDMQSLLSKESMDSELAKLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYWQRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKMGEVL 531
            VQ L        P+RY+RP+   D  +  D+ L  +IPVID+  LL ++    ELAK   AC +WGFFQL+NHG+    +E++K + E FF    +EK  Y Q P  MEG+GQAFV SEEQKLDWAD+  ++T PV  R    +P  P S RET+E YSMEL+ +A  L   M + L
Sbjct:   17 VQVLAGKELKNLPNRYVRPELEHDDVVPIDNSL--EIPVIDLSRLLDQQYACDELAKFHSACLDWGFFQLINHGVREEVIEKMKVDTEDFFRLPFKEKNAYRQLPNGMEGYGQAFVTSEEQKLDWADMHFLITKPVQERNMRFWPTSPTSFRETMEKYSMELQKVAMCLTGMMAKNL 191          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: LDOX_ARATH (Leucoanthocyanidin dioxygenase OS=Arabidopsis thaliana GN=LDOX PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.171e-18
Identity = 55/181 (30.39%), Postives = 90/181 (49.72%), Query Frame = 1
Query:    7 VQELVKNPALFAPDRYIRPDQDSPLISDDILIS------QIPVIDMQSLLSKESMDSE--LAKLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYW--QRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKM 519
            V+ L K+  +  P  YIRP ++   I+D  L        Q+P ID++++ S +    E  + +L  A  +WG   L+NHG+    +E +KK  E FF+ S+EEK+KY   Q  G ++G+G     +   +L+W D F  +  P   R   ++PK P    E    Y+  L+ LA  +   +
Sbjct:    7 VESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIRENCIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGYGSKLANNASGQLEWEDYFFHLAYPEEKRDLSIWPKTPSDYIEATSEYAKCLRLLATKVFKAL 187          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: FNSI_PETCR (Flavone synthase OS=Petroselinum crispum GN=FNSI PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.904e-16
Identity = 45/162 (27.78%), Postives = 83/162 (51.23%), Query Frame = 1
Query:   52 YIRPDQDSPLISDDILISQIPVIDMQSLLS-KESMDSELA-KLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYWQRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKMGEVL 531
            ++R + + P ++ +   ++IP+I +  L    +    E+  K+  AC++WG FQ+V+HG+ +  + E+ +    FF    EEK +Y    G   GF  + V+  +  +DW +  +  + P++ R    +PK P   R T EVYS +L  L   L+  + E +
Sbjct:   19 FVRDEDERPKVAYNQFSNEIPIISLAGLDDDSDGRRPEICRKIVKACEDWGIFQVVDHGIDSGLISEMTRLSREFFALPAEEKLEYDTTGGKRGGFTISTVLQGDDAMDWREFVTYFSYPINARDYSRWPKKPEGWRSTTEVYSEKLMVLGAKLLEVLSEAM 180          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: LDOX_PERFR (Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 8.696e-16
Identity = 49/182 (26.92%), Postives = 88/182 (48.35%), Query Frame = 1
Query:    1 PCVQELVKNPALFAPDRYIRPDQDSPLISDDILIS-------QIPVIDMQSLLSKESMDSELA--KLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYW--QRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLIS 513
            P V+EL ++     P  Y+RP+++   I  +IL         Q+P ID++ + S++    +    +L  A  +WG   L+NHG+    ++ +K   + FF   +EEK+ Y   Q  G+++G+G     +   +L+W D F     P H     ++P  PP        Y+ +L+ LA  ++S
Sbjct:   10 PRVEELARSGLDTIPKDYVRPEEELKSIIGNILAEEKSSEGPQLPTIDLEEMDSRDEEGRKKCHEELKKAATDWGVMHLINHGIPEELIDRVKAAGKEFFELPVEEKEAYANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVYPEHKTDLSIWPTKPPDYIPATSEYAKQLRALATKILS 191          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: LDOX_VITVI (Leucoanthocyanidin dioxygenase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.483e-15
Identity = 55/185 (29.73%), Postives = 87/185 (47.03%), Query Frame = 1
Query:    1 PCVQELVKNPALFAPDRYIRPDQDSPLISDDILIS------QIPVIDMQSLLSKESM------DSELAKLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYW--QRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLIS 513
            P V+ L  +     P  YIRP ++   I +           Q+P ID++ + S++ +      +    +L  A  EWG   LVNHG+S   +  +K   E FFN  MEEK+KY   Q  G + G+G     +   +L+W D F  +  P   R   ++PK P         YS++L++LA  ++S
Sbjct:    7 PRVESLSSSGIQSIPKEYIRPQEELTSIGNVFEEEKKDEGPQVPTIDLKDIESEDEVVRREIRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQASGKIAGYGSKLANNASGQLEWEDYFFHLIFPEDKRDMTIWPKTPSDYVPATCEYSVKLRSLATKILS 191          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: FLS_PETHY (Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.316e-15
Identity = 51/164 (31.10%), Postives = 82/164 (50.00%), Query Frame = 1
Query:   43 PDRYIRPDQDSPLISD-DILISQIPVIDMQSLLSKESMDSELAKLDF-ACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNH-SMEEKKKYWQRPG--DMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKM 519
            P  YIR + + P  +    ++ Q+PVID+     ++  ++++ KL   A KEWG FQL+NHG+    + +L+K  + FF H   EEK+   + PG  D+EG+G +     E K  W D       P        +PK PPS RE  E Y   ++ + + +   +
Sbjct:   32 PSEYIRSENEQPAATTLHGVVLQVPVIDL-----RDPDENKMVKLIADASKEWGIFQLINHGIPDEAIADLQKVGKEFFEHVPQEEKELIAKTPGSNDIEGYGTSLQKEVEGKKGWVDHLFHKIWPPSAVNYRYWPKNPPSYREANEEYGKRMREVVDRIFKSL 190          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: LDOX_PETHY (Leucoanthocyanidin dioxygenase OS=Petunia hybrida GN=ANT17 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.637e-15
Identity = 51/178 (28.65%), Postives = 85/178 (47.75%), Query Frame = 1
Query:    7 VQELVKNPALFAPDRYIRPDQDSPLISDDILIS------QIPVIDMQSLLSKESMDSELA-KLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYW--QRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLIS 513
            V+ L K+     P  Y+RP ++   I +           Q+P ID++ + S++    E   +L  A  EWG   LVNHG+S   +  +K   E FF+  +EEK+KY   Q  G+++G+G     S   +L+W D F     P   R   ++PK P         Y+ +++ LA  +++
Sbjct:   12 VESLAKSGIQAIPKEYVRPQEELNGIGNIFEEEKKDEGPQVPTIDLKEIDSEDKEIREKCHQLKKAAMEWGVMHLVNHGISDELINRVKVAGETFFDQPVEEKEKYANDQANGNVQGYGSKLANSACGQLEWEDYFFHCAFPEDKRDLSIWPKNPTDYTPATSEYAKQIRALATKILT 189          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: FLS_SOLTU (Flavonol synthase/flavanone 3-hydroxylase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.142e-14
Identity = 49/163 (30.06%), Postives = 82/163 (50.31%), Query Frame = 1
Query:   43 PDRYIRPDQDSPLISD-DILISQIPVIDMQSLLSKESMDSELAKLDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNH-SMEEKKKYWQRPG--DMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKM 519
            P  YIR + + P  +    ++ ++PVID+ ++   E  +  + ++  A KEWG FQ++NHG+    +E L+K  + FF     EEK+   ++PG   +EG+G +     E K  W D       P        +PK PPS RE  E Y+  L+ +A+ +   +
Sbjct:   34 PSEYIRSENEQPAATTLQGVVLEVPVIDISNVDDDE--EKLVKEIVEASKEWGIFQVINHGIPDEVIENLQKVGKEFFEEVPQEEKELIAKKPGAQSLEGYGTSLQKEIEGKKGWVDHLFHKIWPPSAINYRYWPKNPPSYREANEEYAKWLRKVADGIFRSL 194          
BLAST of FC868812 vs. ExPASy Swiss-Prot
Match: FL3H_MALDO (Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus domestica PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.142e-14
Identity = 43/162 (26.54%), Postives = 80/162 (49.38%), Query Frame = 1
Query:   49 RYIRPDQDSPLISDDILISQIPVIDMQSLLSKESMDSELAK-LDFACKEWGFFQLVNHGMSTAFLEELKKEVEGFFNHSMEEKKKYWQRPGDMEGFGQAFVVSEEQKLDWADLFSMMTLPVHLRKPHLFPKLPPSLRETLEVYSMELKTLAENLISKMGEVL 531
            +++R + + P ++ +   ++IP+I +  +   E    E+ K +  AC++WG FQ+V+HG+    + E+      FF    EEK ++    G   GF  +  +  E   DW ++ +  + P+  R    +P  P + RE  + YS EL  LA  L+  + E +
Sbjct:   19 KFVRDEDERPKVAYNDFSNEIPIISLAGIDEVEGRRGEICKKIVAACEDWGIFQIVDHGVDAELISEMTGLAREFFALPSEEKLRFDMSGGKKGGFIVSSHLQGEAVQDWREIVTYFSYPIRHRDYSRWPDKPEAWREVTKKYSDELMGLACKLLGVLSEAM 180          
The following BLAST results are available for this feature:
BLAST of FC868812 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 37
Match NameE-valueIdentityDescription
SRG1_ARATH9.184e-5859.78Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
NCS1_COPJA1.685e-3545.76S-norcoclaurine synthase 1 OS=Coptis japonica GN=N... [more]
LDOX_ARATH4.171e-1830.39Leucoanthocyanidin dioxygenase OS=Arabidopsis thal... [more]
FNSI_PETCR3.904e-1627.78Flavone synthase OS=Petroselinum crispum GN=FNSI P... [more]
LDOX_PERFR8.696e-1626.92Leucoanthocyanidin dioxygenase OS=Perilla frutesce... [more]
LDOX_VITVI1.483e-1529.73Leucoanthocyanidin dioxygenase OS=Vitis vinifera P... [more]
FLS_PETHY4.316e-1531.10Flavonol synthase/flavanone 3-hydroxylase OS=Petun... [more]
LDOX_PETHY5.637e-1528.65Leucoanthocyanidin dioxygenase OS=Petunia hybrida ... [more]
FLS_SOLTU2.142e-1430.06Flavonol synthase/flavanone 3-hydroxylase OS=Solan... [more]
FL3H_MALDO2.142e-1426.54Naringenin,2-oxoglutarate 3-dioxygenase OS=Malus d... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005A12EF AbioticL1 Citrus clementina cDNA clone C31005A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868812 ID=FC868812|Name=FC868812|organism=Citrus clementina|type=EST|length=534bp
CCTTGTGTTCAAGAGTTGGTCAAGAATCCGGCGTTATTTGCCCCCGACAG
ATACATACGTCCAGATCAAGATTCACCCCTCATTTCTGATGATATTTTGA
TTTCACAGATACCAGTTATTGACATGCAAAGCTTACTTTCTAAAGAATCA
ATGGACTCTGAGTTAGCCAAGCTCGACTTCGCATGCAAAGAATGGGGTTT
TTTCCAGCTGGTAAATCATGGAATGAGCACAGCATTTCTAGAAGAATTAA
AGAAAGAGGTTGAGGGATTCTTCAATCACAGCATGGAAGAAAAGAAAAAA
TATTGGCAGCGTCCAGGAGATATGGAAGGATTTGGACAAGCCTTTGTTGT
ATCGGAGGAACAAAAGCTTGATTGGGCTGACCTTTTCTCCATGATGACTC
TTCCAGTTCATCTGAGGAAACCACATTTATTTCCTAAGCTCCCTCCTTCC
CTCAGAGAGACCTTGGAAGTTTACTCAATGGAATTAAAAACCCTAGCCGA
GAACCTAATATCGAAAATGGGAGAAGTGTTAAAT
back to top