FC868815

Overview
NameFC868815
Unique NameFC868815
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868815_ssr334 microsatellite FC868815_ssr334:334..345. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig11888 contig Ccv1_Contig11888:815..1516. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868815 vs. ExPASy Swiss-Prot
Match: Y5162_ARATH (Uncharacterized protein At5g41620 OS=Arabidopsis thaliana GN=At5g41620 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 9.954e-20
Identity = 55/200 (27.50%), Postives = 111/200 (55.50%), Query Frame = 3
Query:   15 DQLVSALSMVAALEAEVEQARTRIQELETERRSSKKKLEHFLRKVSEEKAAWRSREHEKIRAFIDDLKAEISRERKNRQRIEIVNSKLVNELADAKVSAKRYMQDYXXXXXXXXXXXXVCDELAKEIGEDKAEVEALKRESM--KLREEVDDERKMLQMAEVWREERVQMKLVDAKVAVEQKYSQMNKLVAELEAFLSSR 608
            +Q VS +S++ AL+ EV  +R RI+EL   +++ + +L+  +++++EEK   +++E E++ + +  ++  +  ERK R+R E ++ K+  EL++ K S    +++             +CDE AK I   + E+  LK++++          ++ +L +AE W +ER+QM+L        +  S ++KL  E+E FL  +
Sbjct:  131 EQHVSNISLIKALKTEVAHSRVRIKELLRYQQADRHELDSVVKQLAEEKLLSKNKEVERMSSAVQSVRKALEDERKLRKRSESLHRKMARELSEVKSSLSNCVKELERGSKSNKMMELLCDEFAKGIKSYEEEIHGLKKKNLDKDWAGRGGGDQLVLHIAESWLDERMQMRLEGGDTLNGKNRSVLDKLEVEIETFLQEK 330          
The following BLAST results are available for this feature:
BLAST of FC868815 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y5162_ARATH9.954e-2027.50Uncharacterized protein At5g41620 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31005B03EF AbioticL1 Citrus clementina cDNA clone C31005B03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868815 ID=FC868815|Name=FC868815|organism=Citrus clementina|type=EST|length=702bp
CCCCGGGCATCGTCGACCAACTGGTAAGTGCTCTATCAATGGTTGCTGCG
CTTGAAGCTGAAGTAGAGCAGGCTCGAACTCGCATTCAGGAGCTTGAGAC
TGAGCGCCGGTCTTCAAAAAAGAAACTTGAGCACTTCTTGAGGAAAGTCA
GTGAGGAAAAGGCCGCATGGCGGAGCAGGGAGCATGAGAAGATCCGTGCA
TTTATTGATGACCTAAAAGCTGAGATAAGCCGAGAAAGGAAAAATCGTCA
AAGGATAGAAATTGTGAATTCCAAATTGGTTAATGAGTTGGCAGACGCAA
AGGTTTCAGCAAAGAGATATATGCAGGACTATGAGAAAGAAAGAAAGGAG
AGAGAATTAATTGAGGAAGTGTGTGATGAGCTCGCCAAGGAAATCGGGGA
AGATAAGGCAGAAGTTGAAGCATTGAAGAGGGAATCGATGAAACTCCGAG
AGGAAGTAGACGATGAAAGGAAGATGTTACAGATGGCCGAGGTGTGGCGT
GAAGAACGTGTTCAAATGAAGCTGGTCGATGCAAAGGTGGCAGTTGAGCA
GAAGTATTCTCAGATGAACAAGCTTGTTGCGGAATTGGAGGCTTTTCTGA
GCTCAAGAAGTATAAATCCAGATATTCAAGAGATGAAAGAAGCAGAGATG
CTTAGACAGGCTGCTGCCTCAGTAATATTCAGGAAATCAGGAATTTACAT
AT
back to top