FC868817

Overview
NameFC868817
Unique NameFC868817
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length652
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig588 contig Ccv1_Contig588:44..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.480e-75
Identity = 141/178 (79.21%), Postives = 156/178 (87.64%), Query Frame = 3
Query:  123 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT KD+WKGLAYD  DDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN MDG YIAPAFMDKLVVHITKNF+SLPNIK+PLILGIWGGKGQGKSFQCELVFAKMGINPIMMS
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 190          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 2.480e-75
Identity = 141/178 (79.21%), Postives = 156/178 (87.64%), Query Frame = 3
Query:  123 PLSFNGSGAATS-VPSSSFFGTSLKKVSSRIPPSKVPSASFKITA-EVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            PLS NGSGA  S VPS++FFG+SLKK +++ P  K  S +FKI A E+ E++QT KD+WKGLAYD  DDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN MDG YIAPAFMDKLVVHITKNF+SLPNIK+PLILGIWGGKGQGKSFQCELVFAKMGINPIMMS
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 190          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 3.239e-75
Identity = 136/176 (77.27%), Postives = 152/176 (86.36%), Query Frame = 3
Query:  123 PLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            P + NGS ++ SVPSS+F G+SLKKV+SR   SKV S S +I A VDE+KQT KDRWKGLA+D  DDQQDITRGKG VDSLFQAP G+GTH+A+MSSY+YIS GLR YN DN MDG YIAPAFMDKLVVHITKNFM+LPN+KVPLILGIWGGKGQGKSFQCELVFAKM I+PIMMS
Sbjct:   15 PPNLNGSSSSASVPSSTFLGSSLKKVNSRFTNSKVSSGSLRIVASVDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYISTGLRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNMKVPLILGIWGGKGQGKSFQCELVFAKMRISPIMMS 190          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 274.248 bits (700), Expect = 3.959e-73
Identity = 139/179 (77.65%), Postives = 153/179 (85.47%), Query Frame = 3
Query:  126 LSFNGSGAATSVPSSSFFGTSLKK-VSSRIPPSKVPSASFKITA---EVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            L+ NGSGA  S P+S+FFGTSLKK V+SR+P SKV + SFKI A   E++E++QT KDRWKGLAYD  DDQQDITRGKG VD LFQAPM  GTHYAVMSSY+Y+S GLR   LDN  DG YIAPAF+DKLVVHITKNFM+LPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS
Sbjct:   16 LNLNGSGAGASAPTSAFFGTSLKKAVASRVPNSKVTNGSFKIVAAEKEIEESQQTNKDRWKGLAYDISDDQQDITRGKGMVDPLFQAPMDAGTHYAVMSSYEYLSTGLR--QLDNIKDGFYIAPAFLDKLVVHITKNFMTLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 192          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA_PHAVU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus vulgaris GN=RCA1 PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 6.754e-73
Identity = 136/179 (75.98%), Postives = 151/179 (84.36%), Query Frame = 3
Query:  126 LSFNGSGAATSVPSSSFFGTSLKKV-SSRIPPSKVPSASFKITA---EVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            L+ NGSG   S PSS+FFGTSLKKV SSR+P SK+ S SFKI A   E++E +QT+ DRW+GLAYD  DDQQDITRGKG VDSLFQAPM  GTHYAV+SS+ Y+S GLR YN DN  DG YIAPAF+DKLVVHI KNFM+LPNIKVPLILG+WGGKGQGKSFQCELVFAKMGINPIMMS
Sbjct:   16 LNLNGSGGGASGPSSAFFGTSLKKVISSRVPNSKLTSGSFKIVAADKEIEETQQTEGDRWRGLAYDVSDDQQDITRGKGLVDSLFQAPMDAGTHYAVISSHKYLSAGLRQYNFDNIKDGFYIAPAFLDKLVVHIAKNFMTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGINPIMMS 194          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 265.003 bits (676), Expect = 2.402e-70
Identity = 137/191 (71.73%), Postives = 153/191 (80.10%), Query Frame = 3
Query:  108 MAAAV---------PLSFNGSGA-ATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            MAAAV         PLS NGSG+ A S P+S+F G  +  VS     +K  + SFK+ A V E+KQT  DRW+GLAYD  DDQQDITRGKG VDS+FQAPMGTGTH+AV+SSY+Y+SQGLR YNLDN MDG YIAPAFMDKLVVHITKNF++LPNIKVPLILGIWGGKGQGKSFQCELV AKMGINPIMMS
Sbjct:    1 MAAAVSTVGAINRAPLSLNGSGSGAVSAPASTFLGKKVVTVSRFAQSNKKSNGSFKVLA-VKEDKQTDGDRWRGLAYDTSDDQQDITRGKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLRQYNLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMAKMGINPIMMS 190          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA1_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 3.137e-70
Identity = 133/180 (73.89%), Postives = 146/180 (81.11%), Query Frame = 3
Query:  123 PLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE   VD  KQT  DRWKGL  D  DDQQDITRGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YNLDN +DG YIAPAFMDKLVVHITKNF+ LPNIKVPLILGIWGGKGQGKSFQCELVF KMGINPIMMS
Sbjct:   15 PLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNKSLRIVAEQIDVDPKKQTDSDRWKGLVQDFSDDQQDITRGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNLDNKLDGFYIAPAFMDKLVVHITKNFLKLPNIKVPLILGIWGGKGQGKSFQCELVFRKMGINPIMMS 194          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA2_TOBAC (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Nicotiana tabacum GN=RCA PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.469e-69
Identity = 130/184 (70.65%), Postives = 146/184 (79.35%), Query Frame = 3
Query:  111 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITAE---VDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            A   PLS N S A TSVPS++FFG +LKKV  + +   KV + S +I AE    D  KQT  DRWKGL  D  DDQQDI RGKG VDSLFQAP GTGTH+AV+ SY+Y+SQGLR YN+DNT+DG YIAP+FMDKLVVHITKNF+ LPNIKVPLILG+WGGKGQGKSFQCELVF KMGINPIMMS
Sbjct:   11 ANKAPLSLNNSVAGTSVPSTAFFGKTLKKVYGKGVSSPKVTNRSLRIAAEEKDADPKKQTYSDRWKGLVQDFSDDQQDIARGKGMVDSLFQAPTGTGTHHAVLQSYEYVSQGLRQYNMDNTLDGFYIAPSFMDKLVVHITKNFLKLPNIKVPLILGVWGGKGQGKSFQCELVFRKMGINPIMMS 194          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 3.835e-68
Identity = 127/183 (69.40%), Postives = 146/183 (79.78%), Query Frame = 3
Query:  102 SLMAAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSRIPPSKVPSASFKITAEVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            S + A    + N S     VP+S+F G+ LK VSSR   SK+ + +FKI AE DE KQT+KD+W+GLA+D  DDQQDITRGKG  D LFQAPMGTGTH AV+SSY+YIS GLR Y+ DN +DG YIAPAFMDKL VHI KNF++LPNIKVPLILG+WGGKGQGKSFQCELVFAKMGINPIMMS
Sbjct:    6 STIGAVNRTTLNNSNYGGLVPNSAFLGSRLK-VSSRFTTSKMVTGNFKIVAEQDEEKQTEKDKWRGLAFDTSDDQQDITRGKGLADPLFQAPMGTGTHNAVLSSYEYISAGLRDYSYDNNVDGFYIAPAFMDKLTVHIVKNFLTLPNIKVPLILGVWGGKGQGKSFQCELVFAKMGINPIMMS 187          
BLAST of FC868817 vs. ExPASy Swiss-Prot
Match: RCA_SOLPN (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Solanum pennellii PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.457e-67
Identity = 128/182 (70.33%), Postives = 150/182 (82.42%), Query Frame = 3
Query:  111 AAAVPLSFNGSGAATSVPSSSFFGTSLKKVSSR-IPPSKVPSASFKITA-EVDENKQTKKDRWKGLAYDEPDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTMDGLYIAPAFMDKLVVHITKNFMSLPNIKVPLILGIWGGKGQGKSFQCELVFAKMGINPIMMS 650
            A+  PLS N S A TSVPS++FFG SLKKV ++ +   KV + + ++ A EVDE   TK+DRWKGL  +  DDQQDI RGKG VDSLFQAP GTGTH+A+M+SY+Y+SQ L+TY LDN +DG YIAPAFMDKLVVHITKNF++LPNIKVPLILG+WGGKGQGKSFQCELVF KMGINPIMMS
Sbjct:   11 ASKAPLSLNNSVAGTSVPSTAFFGKSLKKVYAKGVSSPKVSNRNLRVVAQEVDE---TKEDRWKGLYDNTSDDQQDIARGKGLVDSLFQAPTGTGTHHAIMNSYEYVSQALKTYQLDNKLDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGVWGGKGQGKSFQCELVFRKMGINPIMMS 189          
The following BLAST results are available for this feature:
BLAST of FC868817 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
RCA2_LARTR2.480e-7579.21Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_LARTR2.480e-7579.21Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO3.239e-7577.27Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU3.959e-7377.65Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAVU6.754e-7375.98Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH2.402e-7071.73Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA1_TOBAC3.137e-7073.89Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_TOBAC3.469e-6970.65Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA3.835e-6869.40Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_SOLPN1.457e-6770.33Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005B05EF AbioticL1 Citrus clementina cDNA clone C31005B05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868817 ID=FC868817|Name=FC868817|organism=Citrus clementina|type=EST|length=652bp
GAAAGAGCACAACACGCACCCAGTCCATTGCTTCGCTTTCCTTTGCCTGC
ATTGCAGCGTGACCCTTTAGCTACTTCAATCACAGCCGTCCAATTCTCGC
TAGCCTAATGGCTGCTGCTGTACCGTTGAGCTTCAATGGCTCTGGTGCTG
CAACCTCTGTCCCAAGCTCATCTTTCTTTGGCACCAGCTTGAAGAAGGTA
AGCTCAAGGATCCCCCCATCCAAGGTCCCTTCTGCGAGCTTCAAGATTAC
TGCTGAAGTCGATGAGAACAAGCAGACCAAGAAGGACAGATGGAAGGGCC
TTGCCTACGACGAACCTGATGACCAACAAGACATCACCAGAGGAAAAGGT
GCTGTGGACTCTCTGTTCCAAGCCCCCATGGGAACCGGAACTCACTATGC
TGTCATGAGTTCTTATGACTACATCAGCCAAGGTCTCCGCACATACAACT
TGGACAACACGATGGACGGTCTCTACATTGCCCCTGCTTTCATGGACAAG
CTTGTTGTTCACATCACCAAGAACTTCATGTCCCTGCCCAACATCAAGGT
TCCTCTCATCTTGGGTATTTGGGGAGGCAAAGGACAAGGAAAATCATTCC
AATGTGAGCTTGTTTTCGCCAAGATGGGCATCAACCCAATTATGATGAGT
GC
back to top