FC868819

Overview
NameFC868819
Unique NameFC868819
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9404 contig Ccv1_Contig9404:1..685. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: RH18_ARATH (DEAD-box ATP-dependent RNA helicase 18 OS=Arabidopsis thaliana GN=RH18 PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.530e-86
Identity = 163/205 (79.51%), Postives = 187/205 (91.22%), Query Frame = 3
Query:   72 SNPNKALTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASS-ARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMERMDVLDFRNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +N NKALTETRFSDL+P LS  ++EAL ++ FEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRR++S   KPHQ+MG+IISPTRELS+QIY+VAQPF+STL +V SVLLVGG EVKAD+K IEEEG N+LIGTPGRL DIMERM++LDFRNLEIL+LDEADRLL+MGFQ+Q++YIISRLPK RRTGLFS+  T
Sbjct:    5 ANINKALTETRFSDLEPPLSGDIIEALNQSDFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRSTSFPPKPHQVMGVIISPTRELSTQIYNVAQPFVSTLANVNSVLLVGGREVKADMKIIEEEGCNVLIGTPGRLSDIMERMEILDFRNLEILILDEADRLLEMGFQRQVNYIISRLPKQRRTGLFSATQT 209          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: RH49_ARATH (DEAD-box ATP-dependent RNA helicase 49 OS=Arabidopsis thaliana GN=RH49 PE=2 SV=2)

HSP 1 Score: 297.745 bits (761), Expect = 3.650e-80
Identity = 150/209 (71.77%), Postives = 182/209 (87.08%), Query Frame = 3
Query:   66 MESNPNKALTET--RFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASS-ARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMERMDVLDFRNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            M+S+P K +T+   RFS+LKP LSE ++EAL  +GFE CTPVQA TIP LCS+KDV VDAATGSGKTLAF++P +EI+RR++S   KPHQ+MG+IISPTRELS+QI+ VA+PF+STLP+V SVLLVGG EV+AD+  +EEEGANLLIGTPGRL D+M+RM+ LDFRNLEIL+LDEADRLLDMGFQKQ++YIISRLPK RRTGLFS+  T
Sbjct:    1 MDSSPPKTITKALPRFSELKPPLSEDIIEALDRSGFEVCTPVQAETIPFLCSHKDVVVDAATGSGKTLAFLLPFIEIIRRSNSYPPKPHQVMGVIISPTRELSAQIHKVAEPFVSTLPNVNSVLLVGGREVEADMNTLEEEGANLLIGTPGRLSDMMKRMEFLDFRNLEILILDEADRLLDMGFQKQVNYIISRLPKQRRTGLFSATQT 209          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: RH18_ORYSJ (DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 2.616e-78
Identity = 144/200 (72.00%), Postives = 176/200 (88.00%), Query Frame = 3
Query:   84 KALTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASSARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMERMDVLDFRNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +ALTE RFS+L PALS  V++AL   GF  CTPVQAA IPLL S+KDVAVDAATGSGKTLAFVVP+VEILRR  S  KPH+++G+IISPTRELSSQIY+VAQPF +TL  V S+LLVGG ++KA++KK+EEEGAN+L+GTPG+L+D+MER+D L+++NLEIL+LDEADRLLD+GFQKQI+ IIS+LPKLRRTGLFS+  T
Sbjct:   16 RALTEQRFSELSPALSPEVVKALKGGGFRRCTPVQAAAIPLLLSHKDVAVDAATGSGKTLAFVVPVVEILRRRPSPPKPHEVLGIIISPTRELSSQIYNVAQPFFATLKGVSSMLLVGGFDIKAELKKLEEEGANILVGTPGKLFDVMERLDTLNYKNLEILILDEADRLLDLGFQKQITSIISKLPKLRRTGLFSATQT 215          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: RH55_ARATH (DEAD-box ATP-dependent RNA helicase 55 OS=Arabidopsis thaliana GN=RH55 PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.218e-67
Identity = 135/210 (64.29%), Postives = 165/210 (78.57%), Query Frame = 3
Query:   66 MESNPNKALTET---RFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASS-ARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMERMDVLDFRNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            M+S+P   + E    RFS+LKP LSE ++EAL  +GFE CTPVQA TIP LCS+KDV VDAATGSGKTLAF++P +EI+RR++S   KPHQ+MG+IISPTRELS+QI+ VA+         +        EV+AD+  +EEEGANLLIGTPGRL D+M+RM+ LDFRNLEIL+LDEADRLLDMGFQKQ++YIISRLPK RRTGLFS+  T
Sbjct:    1 MDSSPPNTIIEEAPPRFSELKPPLSEDIIEALDRSGFEVCTPVQAETIPFLCSHKDVVVDAATGSGKTLAFLLPFIEIIRRSNSYPPKPHQVMGVIISPTRELSAQIHKVARAVRLDFAKCR--------EVEADMNTLEEEGANLLIGTPGRLSDMMKRMEFLDFRNLEILILDEADRLLDMGFQKQVNYIISRLPKQRRTGLFSATQT 202          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: DDX55_CHICK (ATP-dependent RNA helicase DDX55 OS=Gallus gallus GN=DDX55 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.829e-47
Identity = 105/205 (51.22%), Postives = 137/205 (66.83%), Query Frame = 3
Query:   84 KALTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASSARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMER-MDVLDF----RNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +A+TE  +S L  ALS  VL AL + GF+  TPVQ+ATIPL  S KDVA +A TGSGKTLAFV+P++EIL R     K  Q+  +II+PTREL+ QI  V   F    P    +LL+GG     DV+K +E G N+++ TPGRL D+  R  D LD     ++L++LVLDEADRLLDMGF+  ++ I++ LPK RRTGLFS+  T
Sbjct:    2 EAVTEGGWSSLPVALSPGVLRALQDLGFDRMTPVQSATIPLFMSNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKMQVGAIIITPTRELAIQIDEVLTHFTKHFPKFSQILLIGGRNPMEDVEKFKEHGGNIIVATPGRLEDLFRRKADGLDLASCVKSLDVLVLDEADRLLDMGFESSLNAILAFLPKQRRTGLFSATQT 206          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: DDX55_DANRE (ATP-dependent RNA helicase DDX55 OS=Danio rerio GN=ddx55 PE=2 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 2.235e-45
Identity = 98/203 (48.28%), Postives = 134/203 (66.01%), Query Frame = 3
Query:   90 LTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASSARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMER-MDVLDF----RNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +T+ ++  L   L + +L+ L E GF + TPVQ+A IPL  S KDVA +A TGSGKTLAFV+P +EIL +     K  Q+  +II+PTREL+ QI  V   F+   P    +LL+GG     DV+K++ +GAN++I TPGRL D+  R  D LD     ++L++LVLDEADRLLDMGF+  ++ I+  LPK RRTGLFS+  T
Sbjct:    4 ITDGKWGSLPVKLHDNILQTLKELGFTYMTPVQSACIPLFMSNKDVAAEAVTGSGKTLAFVIPALEILLKREEKLKKMQVGALIITPTRELAMQISEVMGRFLQGFPQFTQILLIGGSNPIEDVEKLKTQGANIIIATPGRLEDMFRRKADGLDLATAVKSLDVLVLDEADRLLDMGFEASLNTILGYLPKQRRTGLFSATQT 206          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: DDX55_HUMAN (ATP-dependent RNA helicase DDX55 OS=Homo sapiens GN=DDX55 PE=1 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 1.892e-44
Identity = 99/203 (48.77%), Postives = 131/203 (64.53%), Query Frame = 3
Query:   90 LTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASSARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMER-MDVLDF----RNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +TE  +  L   L   VL AL E GF + TPVQ+ATIPL    KDVA +A TGSGKTLAFV+P++EIL R     K  Q+  +II+PTREL+ QI  V   F    P+   +L +GG     DV++ +++G N+++ TPGRL D+  R  + LD     R+L++LVLDEADRLLDMGF+  I+ I+  LPK RRTGLFS+  T
Sbjct:    4 VTEGSWESLPVPLHPQVLGALRELGFPYMTPVQSATIPLFMRNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKSQVGAIIITPTRELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGEDVERFKQQGGNIIVATPGRLEDMFRRKAEGLDLASCVRSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQT 206          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: DDX55_BOVIN (ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=DDX55 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 9.391e-44
Identity = 100/203 (49.26%), Postives = 126/203 (62.07%), Query Frame = 3
Query:   90 LTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASSARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMER-MDVLDF----RNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +TE  +  L   L   VL  L E GF + TPVQ+ATIPL    KDVA +A TGSGKTLAFV+P+ EIL R     K  Q+  +II+PTREL+ QI  V   F    P    +L +GG     DV + +E G N+++ TPGRL D+  R  + LD     R+LE+LVLDEADRLLDMGF+  I+ I+  LPK RRTGLFS+  T
Sbjct:    4 VTEGSWESLPVPLHPKVLSVLRELGFPYMTPVQSATIPLFMKNKDVAAEAVTGSGKTLAFVIPIEEILLRREEKFKKSQVGAIIITPTRELAVQIEEVLSHFTKPFPQFSQILWIGGRNPGEDVARFKELGGNIIVATPGRLEDMFRRKAEGLDLASCVRSLEVLVLDEADRLLDMGFETSINTILEFLPKQRRTGLFSATQT 206          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: DDX55_MOUSE (ATP-dependent RNA helicase DDX55 OS=Mus musculus GN=Ddx55 PE=2 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 1.602e-43
Identity = 97/203 (47.78%), Postives = 130/203 (64.04%), Query Frame = 3
Query:   90 LTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASSARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMER-MDVLDF----RNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +TE  +  L+  L   VL AL E GF   TPVQ+ATIPL    KDVA +A TGSGKTLAFV+P++EIL R     K +Q+  ++I+PTREL+ QI  V   F    P    +L +GG     DV++ ++ G N+++ TPGRL D+  R  + LD     ++L++LVLDEADRLLDMGF+  I+ I+  LPK RRTGLFS+  T
Sbjct:    4 VTEGAWESLQVPLHPRVLGALRELGFPHMTPVQSATIPLFMKNKDVAAEAVTGSGKTLAFVIPILEILLRREEKLKKNQVGAIVITPTRELAIQIDEVLSHFTKHFPQFSQILWIGGRNPGEDVERFKQHGGNIIVATPGRLEDMFRRKAEGLDLASCVKSLDVLVLDEADRLLDMGFEASINTILEFLPKQRRTGLFSATQT 206          
BLAST of FC868819 vs. ExPASy Swiss-Prot
Match: DDX55_XENLA (ATP-dependent RNA helicase DDX55 OS=Xenopus laevis GN=ddx55 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 2.092e-43
Identity = 96/203 (47.29%), Postives = 128/203 (63.05%), Query Frame = 3
Query:   90 LTETRFSDLKPALSEPVLEALAEAGFEFCTPVQAATIPLLCSYKDVAVDAATGSGKTLAFVVPLVEILRRASSARKPHQIMGMIISPTRELSSQIYHVAQPFISTLPDVKSVLLVGGVEVKADVKKIEEEGANLLIGTPGRLYDIMERM-DVLDF----RNLEILVLDEADRLLDMGFQKQISYIISRLPKLRRTGLFSSYST 683
            +TE  +  L   L+  +   L E  F   TPVQ+ATIPL  + KD+A +A TGSGKTLAFV+PL+EIL +     K +Q+  +II+PTREL+ QI  V   F    P    +LL+GG     DV+K +E G N+++ TPGRL D+  R  D LD     + L++L+LDEADRLLDMGF+  I+ I+  LPK RRTGLFS+  T
Sbjct:    4 VTEGTWDSLPQKLNGSIRRTLEELKFTHMTPVQSATIPLFMNNKDIAAEAITGSGKTLAFVIPLLEILLKREEKLKKNQVGALIITPTRELAVQIDEVLSCFTKHFPQFSQILLIGGSNPVDDVRKFKEHGGNIIVATPGRLEDMFRRQADGLDLVICVKTLDVLILDEADRLLDMGFEASINTILGFLPKQRRTGLFSATQT 206          
The following BLAST results are available for this feature:
BLAST of FC868819 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RH18_ARATH1.530e-8679.51DEAD-box ATP-dependent RNA helicase 18 OS=Arabidop... [more]
RH49_ARATH3.650e-8071.77DEAD-box ATP-dependent RNA helicase 49 OS=Arabidop... [more]
RH18_ORYSJ2.616e-7872.00DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sa... [more]
RH55_ARATH1.218e-6764.29DEAD-box ATP-dependent RNA helicase 55 OS=Arabidop... [more]
DDX55_CHICK1.829e-4751.22ATP-dependent RNA helicase DDX55 OS=Gallus gallus ... [more]
DDX55_DANRE2.235e-4548.28ATP-dependent RNA helicase DDX55 OS=Danio rerio GN... [more]
DDX55_HUMAN1.892e-4448.77ATP-dependent RNA helicase DDX55 OS=Homo sapiens G... [more]
DDX55_BOVIN9.391e-4449.26ATP-dependent RNA helicase DDX55 OS=Bos taurus GN=... [more]
DDX55_MOUSE1.602e-4347.78ATP-dependent RNA helicase DDX55 OS=Mus musculus G... [more]
DDX55_XENLA2.092e-4347.29ATP-dependent RNA helicase DDX55 OS=Xenopus laevis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005B07EF AbioticL1 Citrus clementina cDNA clone C31005B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868819 ID=FC868819|Name=FC868819|organism=Citrus clementina|type=EST|length=685bp
GGTTTTCAGTAGGTATCAATGGATGCTATCTGACTCCGAATCCGCGCTTG
CCTTGAACCGTTAGAATGGAGTCCAACCCGAACAAAGCGTTAACAGAAAC
TCGCTTTTCCGATTTGAAGCCGGCGCTTTCCGAGCCAGTTCTCGAAGCCT
TAGCTGAAGCCGGCTTTGAGTTTTGCACGCCTGTTCAAGCTGCCACAATC
CCTTTGTTATGCAGCTACAAGGACGTAGCCGTGGACGCCGCCACCGGCTC
TGGCAAAACCCTAGCTTTTGTCGTCCCTCTAGTGGAGATCCTCCGCCGTG
CCTCTTCTGCTCGGAAACCCCACCAGATAATGGGGATGATTATCTCACCA
ACAAGGGAGCTATCATCGCAAATATACCATGTTGCACAGCCGTTCATCTC
AACTTTACCGGATGTTAAGTCTGTGCTTCTTGTGGGAGGTGTGGAGGTGA
AAGCAGATGTGAAGAAAATAGAGGAAGAAGGAGCAAATTTGTTGATCGGG
ACACCTGGGAGGCTATATGATATAATGGAACGTATGGATGTCTTGGATTT
TCGGAACCTTGAGATTTTGGTTCTAGATGAGGCTGACAGGCTCTTGGATA
TGGGATTCCAGAAACAGATCAGTTACATCATATCTCGCCTGCCTAAACTT
CGTAGAACTGGCCTTTTTTCNAGCTACTCAACTGA
back to top