FC868824

Overview
NameFC868824
Unique NameFC868824
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length646
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868824_ssr40 microsatellite FC868824_ssr40:40..51. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9360 contig Ccv1_Contig9360:1..646. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.032e-73
Identity = 135/181 (74.59%), Postives = 149/181 (82.32%), Query Frame = 1
Query:  103 IGVKEMLGNPLNVSSAVRTSAPGASNPSTFKPVALFXXXXXXXXXXXXXXXXXXXNEELAKWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVFAVIAEIVL 645
            +GV EMLG PLN  +  R+SAP AS+PSTFK VALF                   ++ELAKWYGPDRRIFLP+GLLDRSEIPEYL GEV GDYGYDPFGL KKP++F+KYQA+ELIHARWAMLGAAGFIIPEA NK+GANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLV AV+AE+VL
Sbjct:    4 LGVSEMLGTPLNFRAVSRSSAPLASSPSTFKTVALFSKKKPAPAKSKAVSET---SDELAKWYGPDRRIFLPDGLLDRSEIPEYLNGEVAGDYGYDPFGLGKKPENFAKYQAFELIHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVL 181          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB2_DUNTE (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Dunaliella tertiolecta PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 2.182e-23
Identity = 55/124 (44.35%), Postives = 75/124 (60.48%), Query Frame = 1
Query:  283 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLVFAVIAEIVL 645
            ++YGPDR  FL  G    ++ PEYLTGE PGDYG+D  GLS  P  F++Y+  ELIHARWA+LGA G + PE  +++      E VWFK GA +     LNY G    I   +++  +  ++VL
Sbjct:   32 EFYGPDRAKFL--GPFSENDTPEYLTGEFPGDYGWDTAGLSADPQTFARYREIELIHARWALLGALGILTPELLSQYAGVQFGEPVWFKAGAQIFADGGLNYLGNESLIHAQSIIATLAVQVVL 153          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 5.374e-22
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 594
            WYGPDR  +L        +IP YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE  +K G   G EAVWFK G+ +     L+Y G
Sbjct:   49 WYGPDRPKYLGPF---SDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFG-EAVWFKAGSQIFSEGGLDYLG 147          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB2B_PINSY (Chlorophyll a-b binding protein type 2 member 1B, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 7.019e-22
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 594
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P++F+K +  E+IH RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G
Sbjct:   58 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLG 156          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB2_CHLMO (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Chlamydomonas moewusii PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.167e-22
Identity = 54/124 (43.55%), Postives = 71/124 (57.26%), Query Frame = 1
Query:  283 KWYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI---NLVFAVIAEIVL 645
            +WYGPDR  +L       +  P YLTGE PGDYG+D  GLS  P+ F KY+  E+IHARWA+LGA G + PE  + +      E VWFK GA +     L+Y G    I   N+V  +  ++VL
Sbjct:   38 EWYGPDRAKWLGPF---STNTPAYLTGEFPGDYGWDTAGLSADPETFKKYRELEVIHARWALLGALGILTPELLSTYAGVKFGEPVWFKAGAQIFSEGGLDYLGSPALIHAQNIVATLAVQVVL 158          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB2A_PINSY (Chlorophyll a-b binding protein type 2 member 1A, chloroplastic OS=Pinus sylvestris PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.167e-22
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 594
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G
Sbjct:   62 WYGPDRVLYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLG 160          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB29_MAIZE (Chlorophyll a-b binding protein M9, chloroplastic OS=Zea mays GN=CAB-M9 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.167e-22
Identity = 53/103 (51.46%), Postives = 66/103 (64.08%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 594
            WYGPDR ++L  G L   E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK G+ +     L+Y G
Sbjct:   49 WYGPDRVLYL--GPLS-GEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGSQIFSEGGLDYLG 147          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB2A_PYRPY (Chlorophyll a-b binding protein 1A, chloroplastic OS=Pyrus pyrifolia PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.197e-21
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 594
            WYGPDR ++L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH+RWAMLGA G + PE   + G   G EAVWFK GA +     L+Y G
Sbjct:   62 WYGPDRVMYLGPF---SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLARNGVKFG-EAVWFKAGAQIFSEGGLDYLG 160          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB28_PEA (Chlorophyll a-b binding protein 8, chloroplastic OS=Pisum sativum GN=CAB8 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.197e-21
Identity = 52/103 (50.49%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 594
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ FSK +  E+IH+RWAMLGA G + PE  ++ G   G EAVWFK G+ +     L+Y G
Sbjct:   52 WYGPDRVKYLGPF---SGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFG-EAVWFKAGSQIFSEGGLDYLG 150          
BLAST of FC868824 vs. ExPASy Swiss-Prot
Match: CB24_PETSP (Chlorophyll a-b binding protein 25, chloroplastic OS=Petunia sp. GN=CAB25 PE=3 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.197e-21
Identity = 52/103 (50.49%), Postives = 63/103 (61.17%), Query Frame = 1
Query:  286 WYGPDRRIFLPEGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPDDFSKYQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFG 594
            WYGPDR  +L        E P YLTGE PGDYG+D  GLS  P+ F+K +  E+IH RWAMLGA G + PE F + G   G EAVWFK G+ +     L+Y G
Sbjct:   50 WYGPDRVKYLGPF---SGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFG-EAVWFKAGSQIFSEGGLDYLG 148          
The following BLAST results are available for this feature:
BLAST of FC868824 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 64
Match NameE-valueIdentityDescription
CB26_ARATH1.032e-7374.59Chlorophyll a-b binding protein CP26, chloroplasti... [more]
CB2_DUNTE2.182e-2344.35Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_GOSHI5.374e-2250.49Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB2B_PINSY7.019e-2250.49Chlorophyll a-b binding protein type 2 member 1B, ... [more]
CB2_CHLMO9.167e-2243.55Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB2A_PINSY9.167e-2250.49Chlorophyll a-b binding protein type 2 member 1A, ... [more]
CB29_MAIZE9.167e-2251.46Chlorophyll a-b binding protein M9, chloroplastic ... [more]
CB2A_PYRPY1.197e-2150.49Chlorophyll a-b binding protein 1A, chloroplastic ... [more]
CB28_PEA1.197e-2150.49Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB24_PETSP1.197e-2150.49Chlorophyll a-b binding protein 25, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005C02EF AbioticL1 Citrus clementina cDNA clone C31005C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868824 ID=FC868824|Name=FC868824|organism=Citrus clementina|type=EST|length=646bp
GACTCTCATCTTCACCATTTCATTTCTCTAACACAAAGAAGCAGCAGCAG
CAACACTCTGAAGATGGCTTCATTGGCAGCATCGTCCACTCCTGCTGCCT
CCATTGGAGTTAAGGAGATGCTTGGCAACCCTCTCAATGTCAGCAGTGCT
GTTAGGACTTCAGCTCCAGGTGCATCAAACCCTTCTACTTTCAAGCCCGT
TGCTCTCTTCTCCAAGAAGAAAGCCGCCCCTCCTGCCAAGTCTAAGCCCG
TCGCCGTCTCCCCCGTTAACGAAGAGCTCGCCAAGTGGTATGGTCCTGAC
CGAAGAATTTTCTTGCCCGAGGGTCTCTTGGACAGATCTGAGATCCCTGA
GTACTTGACCGGAGAAGTTCCCGGAGACTATGGTTACGATCCTTTTGGTC
TCAGCAAGAAACCAGACGACTTCAGCAAATATCAGGCATATGAATTGATT
CATGCCAGATGGGCCATGCTTGGTGCTGCTGGTTTCATCATTCCTGAAGC
CTTTAACAAGTTTGGTGCTAACTGTGGTCCTGAAGCTGTCTGGTTCAAGA
CTGGAGCTCTACTTCTTGATGGAAACACATTGAACTACTTCGGAAAGAAC
ATCCCAATCAACCTTGTTTTTGCTGTCATTGCTGAGATTGTTCTTG
back to top