FC868826

Overview
NameFC868826
Unique NameFC868826
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length715
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9405 contig Ccv1_Contig9405:1..715. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SWI3B_ARATH (SWI/SNF complex subunit SWI3B OS=Arabidopsis thaliana GN=SWI3B PE=1 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.847e-59
Identity = 112/189 (59.26%), Postives = 138/189 (73.02%), Query Frame = 1
Query:  142 DVVNVPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINY--FASVKTLKW--XXXXXXXXXXXXXXXXXXXXXXXRLCNGCKTLCTIACFACDKYDLTLCARCYVXWYHRVGVSSSDFRRVEISEEARSDWTEKETL 696
            D ++VPSYS WFS+  I++CEV+ LPEFFDSRS SKNP+ Y Y R+SI+K YR++  RKI+FTDVRRTLV DV SIRRVFDFL++WGLINY   AS K LKW                         R CNGCK +C+IACFACDKYDLTLCARCYV   +RVG++SS+F+RVEISEE++ +W++KE L
Sbjct:   46 DNIHVPSYSSWFSWTDINDCEVRSLPEFFDSRSSSKNPKFYLYLRNSIIKQYRDDHPRKISFTDVRRTLVSDVVSIRRVFDFLDSWGLINYNSSASAKPLKWEEKEAGKSAGDAASEPATTVKETAKRNCNGCKAICSIACFACDKYDLTLCARCYVRSNYRVGINSSEFKRVEISEESKPEWSDKEIL 234          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SWI3A_ARATH (SWI/SNF complex subunit SWI3A OS=Arabidopsis thaliana GN=SWI3A PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.843e-20
Identity = 44/96 (45.83%), Postives = 66/96 (68.75%), Query Frame = 1
Query:  142 DVVNVPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINYFASVK 429
            ++  +P+ S WF +D I E E +   EFF   S ++ P+VY+ YRD I+  +RE+  R++TFT VR+ LVGDV  +++VF FLE WGLIN+ +S+K
Sbjct:   11 ELYTIPAQSSWFLWDDIHEIERREFAEFFTESSITRTPKVYKEYRDFIINKFREDTCRRLTFTSVRKFLVGDVNLLQKVFLFLEKWGLINFSSSLK 106          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SSR1_SCHPO (SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe GN=ssr1 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.084e-19
Identity = 44/89 (49.44%), Postives = 57/89 (64.04%), Query Frame = 1
Query:  148 VNVPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINY 414
            V VP +++WF F  + E E K  PEFFD ++ SK P VY+ YRD ++  +R N    +TFT  RR L GDV ++ RV  FLE WGLINY
Sbjct:   52 VEVPEWAQWFDFSKVHEIEKKQNPEFFDGKNTSKTPEVYKEYRDFMISTFRLNSKVYLTFTACRRNLAGDVCAVLRVHRFLEQWGLINY 140          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SWI3_YEAST (SWI/SNF complex subunit SWI3 OS=Saccharomyces cerevisiae GN=SWI3 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.639e-19
Identity = 44/94 (46.81%), Postives = 58/94 (61.70%), Query Frame = 1
Query:  154 VPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINYFASVKTL 435
            +PSYS+WF+ + I   EV+ LPEFF +R PSK P VY  YR+ +V  YR NP+   + T  RR + GD  ++ R+  FL  WGLINY    K L
Sbjct:  307 IPSYSKWFNLEKIHSIEVQSLPEFFTNRIPSKTPEVYMRYRNFMVNSYRLNPNEYFSVTTARRNVSGDAAALFRLHKFLTKWGLINYQVDSKLL 400          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SSR2_SCHPO (SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe GN=ssr2 PE=1 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 1.479e-18
Identity = 44/87 (50.57%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  154 VPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINY 414
            VPSY+ WF    I + E +  PEFF+ +SP K P +Y+ YRD ++  YR  P+  +T T  RR LVGDV +I RV  FLE WGLINY
Sbjct:   20 VPSYAGWFDMSKIHDIERRSNPEFFNGKSPLKTPSIYKDYRDFMINSYRLEPNEYLTVTACRRNLVGDVCAIIRVHAFLEQWGLINY 106          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SMRC2_MOUSE (SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN=Smarcc2 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.932e-18
Identity = 42/87 (48.28%), Postives = 57/87 (65.52%), Query Frame = 1
Query:  154 VPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINY 414
            +PSY+ WF ++S+   E + LPEFF+ ++ SK P +Y  YR+ ++  YR NP   +T T  RR L GDV +I RV  FLE WGLINY
Sbjct:  426 IPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINY 512          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SMRC2_HUMAN (SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.932e-18
Identity = 42/87 (48.28%), Postives = 57/87 (65.52%), Query Frame = 1
Query:  154 VPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINY 414
            +PSY+ WF ++S+   E + LPEFF+ ++ SK P +Y  YR+ ++  YR NP   +T T  RR L GDV +I RV  FLE WGLINY
Sbjct:  426 IPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINY 512          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SMRC1_MOUSE (SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN=Smarcc1 PE=1 SV=2)

HSP 1 Score: 90.1225 bits (222), Expect = 1.252e-17
Identity = 40/87 (45.98%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  154 VPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINY 414
            +PSY+ WF ++ I   E + LPEFF+ ++ SK P +Y  YR+ ++  YR NP   +T T  RR L GDV ++ RV  FLE WGL+NY
Sbjct:  450 IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNY 536          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: SMRC1_HUMAN (SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3)

HSP 1 Score: 90.1225 bits (222), Expect = 1.252e-17
Identity = 40/87 (45.98%), Postives = 56/87 (64.37%), Query Frame = 1
Query:  154 VPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINY 414
            +PSY+ WF ++ I   E + LPEFF+ ++ SK P +Y  YR+ ++  YR NP   +T T  RR L GDV ++ RV  FLE WGL+NY
Sbjct:  451 IPSYASWFDYNCIHVIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNY 537          
BLAST of FC868826 vs. ExPASy Swiss-Prot
Match: RSC8_YEAST (Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae GN=RSC8 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.692e-14
Identity = 39/95 (41.05%), Postives = 55/95 (57.89%), Query Frame = 1
Query:  148 VNVPSYSRWFSFDSISECEVKFLPEFFDSRSPSKNPRVYRYYRDSIVKHYRENPSRKITFTDVRRTLVGDVGSIRRVFDFLETWGLINYFASVKT 432
            V +PS++ WF    I E E +  P+FF+  S  K P+ Y+  R+ I+  YR +P   +T T VRR +  DV SI ++  FLE WGLINY    +T
Sbjct:   80 VIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRT 174          
The following BLAST results are available for this feature:
BLAST of FC868826 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
SWI3B_ARATH3.847e-5959.26SWI/SNF complex subunit SWI3B OS=Arabidopsis thali... [more]
SWI3A_ARATH7.843e-2045.83SWI/SNF complex subunit SWI3A OS=Arabidopsis thali... [more]
SSR1_SCHPO5.084e-1949.44SWI/SNF and RSC complexes subunit ssr1 OS=Schizosa... [more]
SWI3_YEAST6.639e-1946.81SWI/SNF complex subunit SWI3 OS=Saccharomyces cere... [more]
SSR2_SCHPO1.479e-1850.57SWI/SNF and RSC complexes subunit ssr2 OS=Schizosa... [more]
SMRC2_MOUSE1.932e-1848.28SWI/SNF complex subunit SMARCC2 OS=Mus musculus GN... [more]
SMRC2_HUMAN1.932e-1848.28SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN... [more]
SMRC1_MOUSE1.252e-1745.98SWI/SNF complex subunit SMARCC1 OS=Mus musculus GN... [more]
SMRC1_HUMAN1.252e-1745.98SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN... [more]
RSC8_YEAST1.692e-1441.05Chromatin structure-remodeling complex protein RSC... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005C04EF AbioticL1 Citrus clementina cDNA clone C31005C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868826 ID=FC868826|Name=FC868826|organism=Citrus clementina|type=EST|length=715bp
GGTTGGGAATGCTAGCGAATTTATCATCTCATGGCGGCTAAATCGCCCGT
TAAAGAACCTCCGGGAACGTCCGCCGTTAACCCCACCACTCCTCTTGCGC
CTCCACCCGTCAAGCCCGAGCTACCCTCTTCCTCCGAACCCGACGTCGTT
AACGTCCCCAGCTATTCCAGGTGGTTTTCATTTGACAGCATCAGTGAATG
TGAGGTCAAATTTCTTCCGGAATTTTTCGATTCGCGTTCGCCTTCGAAAA
ACCCTAGGGTTTACAGGTACTATAGGGATTCAATAGTCAAGCATTATAGA
GAGAACCCGTCGAGGAAGATTACGTTTACCGACGTGAGGAGGACTCTTGT
CGGCGATGTGGGATCTATTCGAAGGGTGTTTGATTTCTTGGAGACTTGGG
GACTTATTAATTACTTTGCTTCTGTTAAGACCTTGAAGTGGGAAGATAAA
GAGACCAAGTCCTCTGCTGCTTCTGCTGAATCCTCCTCCGCTCTTAAGGA
GACCTCTAAGAGGCTCTGCAATGGTTGCAAGACCCTTTGTACCATTGCTT
GTTTTGCTTGTGATAAGTATGACTTGACCCTTTGTGCGAGATGCTATGTC
CNGTGGTACCATCGGGTGGGTGTTAGCTCGTCTGATTTCAGGCGGGTCGA
GATCAGTGAGGAGGCTAGATCGGATTGGACAGAGAAAGAAACTTTGCACT
TCTGGAGCCATTATG
back to top