FC868827

Overview
NameFC868827
Unique NameFC868827
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length684
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC868827_ssr98 microsatellite FC868827_ssr98:98..109. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9406 contig Ccv1_Contig9406:1..684. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868827 vs. ExPASy Swiss-Prot
Match: APO2_ARATH (APO protein 2, chloroplastic OS=Arabidopsis thaliana GN=APO2 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 6.314e-32
Identity = 65/111 (58.56%), Postives = 82/111 (73.87%), Query Frame = 3
Query:  351 RVPSKKLQHPYALAARQDYPQNADLPRQYSKREKKPFPIPIVELGRAARARAKNRSGQPRRPVPPPKRGLLVKNLIPVAYDVLNARITLINKSQKLWKVVPVHACVFCNEI 683
            RV   K +    L  R D PQN DLP+QY++REKKPFP+PIV+L RAAR R KN   +P+RP+PPPK G++VK+L+P+AY V NARI LIN   +L KVV V+AC +CNEI
Sbjct:   59 RVVLSKERRSLPLVVRNDRPQNEDLPKQYTRREKKPFPVPIVDLRRAARERVKNNKDKPKRPLPPPKNGMVVKSLVPLAYKVYNARIRLINNLHRLMKVVRVNACGWCNEI 169          
BLAST of FC868827 vs. ExPASy Swiss-Prot
Match: APO1_ARATH (APO protein 1, chloroplastic OS=Arabidopsis thaliana GN=APO1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.144e-11
Identity = 38/91 (41.76%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  411 QNADLPRQYSKREKKPFPIPIVELGRAARARAKNRSGQPRRPVPPPKRGLLVKNLIPVAYDVLNARITLINKSQKLWKVVPVHACVFCNEI 683
            QN DLP    K +KKP+PIP  ++   AR   K       + + PPK GLLV NL+PVA  V++    LI    +L  VVPV AC  C  +
Sbjct:   72 QNVDLPPILPKNKKKPYPIPFKQIQEEARKDKKLAQMGIEKQLDPPKNGLLVPNLVPVADQVIDNWKLLIKGLAQLLHVVPVFACSECGAV 162          
The following BLAST results are available for this feature:
BLAST of FC868827 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
APO2_ARATH6.314e-3258.56APO protein 2, chloroplastic OS=Arabidopsis thalia... [more]
APO1_ARATH6.144e-1141.76APO protein 1, chloroplastic OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31005C06EF AbioticL1 Citrus clementina cDNA clone C31005C06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868827 ID=FC868827|Name=FC868827|organism=Citrus clementina|type=EST|length=684bp
GGGGACCGCAATATTTCTCTTCATTTTCACACTTGTAAGCTCTTTCTTTC
TGTTCACTTCTCTATGAGTATGTCTATTACCCAAAATTTCACATCGTTTA
TTATTATTAAAAGTGTAGCAACTTTTTAAAAACAAAATTTTTCAGGCAAA
ATTTTGTTCTGGGTCTGCTAAAAGAAGTCCCATTTTGGTAAATGGATTTA
TTATCTTGTGGCAAAGTAACAGTTTTCCCTCAACCCAAAGCGGGAACCTC
CATTTTTACACGGAATTCACGACTTAACCTTCACTCAGGTCTTAGCTCTC
TTCATTCTTTGAAGCTTAGTAGCGGAAAATATAAACTTCAATTAAAGTCT
AGAGTTCCATCGAAAAAGTTGCAGCATCCATATGCTTTGGCTGCTAGACA
GGATTATCCGCAAAATGCAGATTTACCTCGGCAGTACTCAAAGAGAGAAA
AGAAGCCATTTCCAATTCCTATAGTGGAGCTGGGGCGAGCTGCTAGAGCA
AGGGCCAAAAATCGGAGTGGCCAACCCAGAAGACCAGTCCCACCTCCAAA
AAGAGGGTTGCTGGTTAAAAACCTTATACCAGTGGCCTATGATGTGTTAA
ATGCGAGAATTACATTGATTAACAAATCTCAGAAGCTCTGGAAAGTGGTG
CCTGTGCATGCTTGCGTATTTTGTAATGAAATTC
back to top