FC868828

Overview
NameFC868828
Unique NameFC868828
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9434 contig Ccv1_Contig9434:1..666. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868828 vs. ExPASy Swiss-Prot
Match: ABA2_PRUAR (Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 3.712e-66
Identity = 132/210 (62.86%), Postives = 161/210 (76.67%), Query Frame = 3
Query:   48 MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGT-SGQSKNPTQMKAAVA---ESPTNNSDSENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIIL 665
            M S++FYNS+NLS AVFSRTHFP+P+ K   +EFS   H  +Y  R+ T SGQ K  T+++A VA   E P+  + ++ KK                   K+KGF+V+VFEKD+SA+RGEGQYRGPIQIQSNALAALEAID+DVAEEVMR GCVTGDRINGLVDG+SG+WY+KFDTFTPA E+GLPVTRVISR+ LQQILA+AVG+EII+
Sbjct:    1 MASTLFYNSMNLSAAVFSRTHFPIPINKDFPLEFSPCIHT-DYHLRSRTRSGQKKCLTEVRATVASPTEVPSAPASTQPKKLRILVAGGGIGGLVFALAAKKKGFDVVVFEKDLSAVRGEGQYRGPIQIQSNALAALEAIDMDVAEEVMRVGCVTGDRINGLVDGVSGTWYVKFDTFTPAVERGLPVTRVISRIALQQILARAVGEEIII 209          
BLAST of FC868828 vs. ExPASy Swiss-Prot
Match: ABA2_SOLLC (Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.496e-54
Identity = 120/217 (55.30%), Postives = 147/217 (67.74%), Query Frame = 3
Query:   48 MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESP---TNNSDS--------ENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIIL 665
            M S++FY SV+ ST+V SR   P+ + K    E      C + +   G   + K   ++KA +AE+P   T  +DS          KK                   K++GF+VLVFE+D+SAIRGEGQYRGPIQIQSNALAALEAIDLDVAE++M AGC+TG RINGLVDGISG+WY KFDTFTPA E+GLPVTRVISRMTLQQILA+AVG+EII+
Sbjct:    1 MYSTVFYTSVHPSTSVLSRKQLPLLISKDFSAELYHSLPCRSLE--NGHINKVKG-VKVKATIAEAPVTPTEKTDSGANGDLKVPQKKLKVLVAGGGIGGLVFALAAKKRGFDVLVFERDLSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEDIMNAGCITGQRINGLVDGISGNWYCKFDTFTPAVERGLPVTRVISRMTLQQILARAVGEEIIM 214          
BLAST of FC868828 vs. ExPASy Swiss-Prot
Match: ABA2_NICPL (Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.604e-53
Identity = 116/212 (54.72%), Postives = 144/212 (67.92%), Query Frame = 3
Query:   48 MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQM-KAAVAESP-----TNNSDSENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIIL 665
            M S++FY SV+ ST+ FSR   P+ + K    E      C     R+  +GQ K    + KA +AE+P     T+      KK                   K++GF+VLVFE+D+SAIRGEGQYRGPIQIQSNALAALEAID+DVAE++M AGC+TG RINGLVDG+SG+WY KFDTFTPA E+GLPVTRVISRMTLQQ LA+AVG++II+
Sbjct:    1 MYSTVFYTSVHPSTSAFSRKQLPLLISKDFPTELYHSLPCS----RSLENGQIKKVKGVVKATIAEAPATIPPTDLKKVPQKKLKVLVAGGGIGGLVFALAAKKRGFDVLVFERDLSAIRGEGQYRGPIQIQSNALAALEAIDMDVAEDIMNAGCITGQRINGLVDGVSGNWYCKFDTFTPAVERGLPVTRVISRMTLQQNLARAVGEDIIM 208          
BLAST of FC868828 vs. ExPASy Swiss-Prot
Match: ABA2_CAPAN (Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.417e-49
Identity = 100/162 (61.73%), Postives = 121/162 (74.69%), Query Frame = 3
Query:  195 SGQSKNPTQMKAAVAESPT-----NNSDSENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIIL 665
            +G  K    +KA +AE+P      +NS+   KK                   K++GF+VLVFE+D+SAIRGEGQYRGPIQIQSNALAALEAID+DVAEE+M AGC+TG RINGLVDGISG+WY KFDTFTPA E+GLPVTRVISRMTLQQILA+  G+++I+
Sbjct:   45 NGHIKKVKGVKATLAEAPATPTEKSNSEVPQKKLKVLVAGGGIGGLVFALAGKKRGFDVLVFERDISAIRGEGQYRGPIQIQSNALAALEAIDMDVAEEIMNAGCITGQRINGLVDGISGNWYCKFDTFTPAVERGLPVTRVISRMTLQQILARLQGEDVIM 206          
The following BLAST results are available for this feature:
BLAST of FC868828 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ABA2_PRUAR3.712e-6662.86Zeaxanthin epoxidase, chloroplastic OS=Prunus arme... [more]
ABA2_SOLLC2.496e-5455.30Zeaxanthin epoxidase, chloroplastic OS=Solanum lyc... [more]
ABA2_NICPL3.604e-5354.72Zeaxanthin epoxidase, chloroplastic OS=Nicotiana p... [more]
ABA2_CAPAN1.417e-4961.73Zeaxanthin epoxidase, chloroplastic OS=Capsicum an... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31005C07EF AbioticL1 Citrus clementina cDNA clone C31005C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868828 ID=FC868828|Name=FC868828|organism=Citrus clementina|type=EST|length=666bp
CCCCGGGGGGGGAGAACACTGCAGAAAGATGCCGTTGGAGAAACAAGATG
GTTTCATCTATGTTCTACAATTCAGTCAATCTTTCAACAGCTGTTTTCTC
AAGAACCCACTTCCCAGTTCCTGTATACAAACATTCTTGCATTGAATTTT
CACGTTATGATCACTGTATTAACTACAAATTCAGGACCGGAACAAGTGGG
CAAAGCAAGAACCCGACACAAATGAAAGCTGCAGTGGCAGAGTCCCCTAC
TAATAACAGTGACAGTGAAAACAAGAAATTGAGGATTTTGGTGGCTGGTG
GTGGGATTGGAGGACTTGTATTTGCTTTGGCTGCTAAAAGGAAAGGATTT
GAAGTGCTGGTGTTTGAGAAAGATATGAGTGCTATAAGAGGTGAGGGACA
ATACAGAGGTCCAATTCAGATACAAAGCAATGCATTGGCTGCTTTGGAAG
CTATTGATTTGGATGTTGCTGAGGAAGTTATGAGAGCTGGATGTGTTACC
GGTGATAGAATTAATGGTTTGGTTGATGGGATTTCTGGTTCTTGGTACAT
CAAGTTTGATACTTTCACTCCTGCAGCAGAAAAGGGACTGCCAGTCACAA
GAGTAATTAGCCGAATGACTTTGCAACAAATACTAGCTAAAGCGGTTGGG
GATGAAATCATTTTGA
back to top