FC868830

Overview
NameFC868830
Unique NameFC868830
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length738
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14169 contig Ccv1_Contig14169:4..741. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 390.578 bits (1002), Expect = 4.735e-108
Identity = 190/226 (84.07%), Postives = 198/226 (87.61%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MATSAIQQSAFAGQTAL+QSNE V K+G   GGR++MRRTVKS P SIWYGPDRPKYLGPFS+Q PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKE+KNGRLAMFS  G
Sbjct:    1 MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFG 226          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 9.873e-106
Identity = 188/226 (83.19%), Postives = 195/226 (86.28%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MATSAIQQSAFAGQTAL+  NE VRK+G   GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  G
Sbjct:    1 MATSAIQQSAFAGQTALKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFG 226          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 2.873e-105
Identity = 185/226 (81.86%), Postives = 196/226 (86.73%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MATSAI+QSAFAGQTAL+  NE VRK+G  +GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WA QVVLMG +EGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  G
Sbjct:    1 MATSAIEQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFG 226          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.426e-104
Identity = 185/226 (81.86%), Postives = 193/226 (85.40%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MAT AIQQSAF GQ   +  NEF+RKVG    GRITMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  G
Sbjct:    1 MATCAIQQSAFVGQAVGKSQNEFIRKVGNFGEGRITMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFG 226          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 7.076e-104
Identity = 184/226 (81.42%), Postives = 192/226 (84.96%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MATSAIQQSAF G+T LRQ NEF+RK G     R TMRRTVKS P+SIWYGPDRPKYLGPFSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPE+L KNGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFS  G
Sbjct:    1 MATSAIQQSAFTGKTGLRQGNEFIRKRGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGPFSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNGRLAMFSMFG 226          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 374.785 bits (961), Expect = 2.689e-103
Identity = 183/226 (80.97%), Postives = 197/226 (87.17%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MA SAIQ SAFAGQTAL+Q +E VRKVGV+DG R +MRRTVK+ PQSIWYG DRPK+LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPE+LSKNGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  G
Sbjct:    1 MAASAIQSSAFAGQTALKQRDELVRKVGVSDG-RFSMRRTVKAVPQSIWYGADRPKFLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSKNGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFG 225          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 6.199e-100
Identity = 184/226 (81.42%), Postives = 193/226 (85.40%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFS  G
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFG 224          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 6.199e-100
Identity = 184/226 (81.42%), Postives = 193/226 (85.40%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFS  G
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFG 224          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 7.577e-98
Identity = 179/228 (78.51%), Postives = 191/228 (83.77%), Query Frame = 3
Query:   60 MAT-SAIQQSAFAGQTALR-QSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVG 737
            MAT SAIQ S+ AGQT LR Q NE V+KVG A   RITMRRTV+S P+SIWYGPDRPKYLGPFSE TPSYLTGEFPGDYGWDTA +SADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNG+KFGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWACQVVLMG +EGYR+                AFDPLGLADDP+  AELKVKE+KNGRLAMFS  G
Sbjct:    1 MATASAIQSSSLAGQTLLRPQQNELVKKVGTAQA-RITMRRTVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPLGLADDPEACAELKVKEIKNGRLAMFSMFG 227          
BLAST of FC868830 vs. ExPASy Swiss-Prot
Match: CB21_SILPR (Chlorophyll a-b binding protein, chloroplastic (Fragment) OS=Silene pratensis PE=2 SV=2)

HSP 1 Score: 345.51 bits (885), Expect = 1.747e-94
Identity = 165/206 (80.10%), Postives = 178/206 (86.41%), Query Frame = 3
Query:   60 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQF 677
            MATS IQQSAFAGQT L+  NE VRKVG  +GGR++MRRT+KS P+SIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNGVKFGEAVWFKAG+QIF EGGLDYLGNPNL+HAQSILAIWACQVVLMG VEGYR+                AFDPLGLA+DP+ F
Sbjct:    1 MATSTIQQSAFAGQTLLKPQNELVRKVG-GNGGRVSMRRTIKSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSILAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF 205          
The following BLAST results are available for this feature:
BLAST of FC868830 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 78
Match NameE-valueIdentityDescription
CB21_GOSHI4.735e-10884.07Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB26_PETSP9.873e-10683.19Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB23_TOBAC2.873e-10581.86Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB24_SOLLC1.426e-10481.86Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB215_PEA7.076e-10481.42Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB21_LEMGI2.689e-10380.97Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_ORYSJ6.199e-10081.42Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI6.199e-10081.42Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_PINTH7.577e-9878.51Chlorophyll a-b binding protein type I, chloroplas... [more]
CB21_SILPR1.747e-9480.10Chlorophyll a-b binding protein, chloroplastic (Fr... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005C11EF AbioticL1 Citrus clementina cDNA clone C31005C11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868830 ID=FC868830|Name=FC868830|organism=Citrus clementina|type=EST|length=738bp
AATTCAGAGTGCGAAAAGAAGCTTCAGCAACAAAAGGAAAAGCTTTCGCA
TAAGAACATATGGCAACCTCTGCTATCCAACAATCAGCATTTGCTGGCCA
GACCGCCTTGAGGCAATCCAATGAGTTTGTCCGCAAGGTTGGAGTTGCTG
ACGGTGGCCGTATCACCATGAGGAGGACTGTCAAATCCACTCCCCAGAGC
ATCTGGTACGGCCCAGACCGCCCAAAGTACTTGGGACCATTCTCTGAGCA
AACACCATCATACTTGACTGGTGAGTTCCCTGGTGACTATGGCTGGGATA
CCGCTGGTTTATCAGCAGACCCCGAGACATTTGCTAAGAACCGTGAGCTA
GAGGTGATCCACAGCAGATGGGCAATGCTTGGAGCTCTTGGCTGCGTCTT
CCCTGAAATCCTCTCCAAGAATGGAGTGAAGTTCGGCGAAGCAGTTTGGT
TCAAGGCTGGCGCTCAAATCTTCTCTGAAGGTGGCCTTGACTATCTTGGC
AACCCCAACCTCATTCATGCTCAGAGCATTTTGGCTATCTGGGCCTGCCA
GGTTGTGCTCATGGGTTTTGTTGAAGGATACAGAATTGGTGGCGGTCCTC
TTGGTGAAGGACTTGACCCACTTTACCCTGGTGGTGCTTTTGACCCACTT
GGTTTGGCTGATGACCCCGATCAATTTGCTGAGTTGAAGGTCAAGGAGCT
CAAGAATGGCCGTCTGGCTATGTTCTCCCATGTTGGAT
back to top