FC868859

Overview
NameFC868859
Unique NameFC868859
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length652
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868859 vs. ExPASy Swiss-Prot
Match: LPP2_ARATH (Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.014e-52
Identity = 97/138 (70.29%), Postives = 107/138 (77.54%), Query Frame = 3
Query:  225 MPEIQLGAHTVRSHGLKVXXXXXXXXXXXXXXXXXXXXXXXXXPFHRFVGEDMMTDLRYPMKDNTVPFWAVPLIAILLPFIVVHVYYFIRRDVYDLHHAILGLLYSVLITGVITDAIKDAVGRPRPDFFWRCFPDGKG 638
            MPEI LGAHT+RSHG+ V                         PFHRFVGEDM+TDLRYP++DNT+PFWAVPLIA++LPF V+ VYYFIR DVYDLHHAILGLL+SVLITGVITDAIKDAVGRPRPDFFWRCFPDG G
Sbjct:    1 MPEIHLGAHTIRSHGVTVARFHMHDWLILLLLIVIEIVLNVIEPFHRFVGEDMLTDLRYPLQDNTIPFWAVPLIAVVLPFAVICVYYFIRNDVYDLHHAILGLLFSVLITGVITDAIKDAVGRPRPDFFWRCFPDGIG 138          
BLAST of FC868859 vs. ExPASy Swiss-Prot
Match: LPP3_ARATH (Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 2.957e-44
Identity = 83/138 (60.14%), Postives = 98/138 (71.01%), Query Frame = 3
Query:  222 KMPEIQLGAHTVRSHGLKVXXXXXXXXXXXXXXXXXXXXXXXXXPFHRFVGEDMMTDLRYPMKDNTVPFWAVPLIAILLPFIVVHVYYFIRRDVYDLHHAILGLLYSVLITGVITDAIKDAVGRPRPDFFWRCFPDGK 635
            +M E QLG HT+RSHG+ V                         PF+RFVG+DMMTDL YP+K NTVP W+VP+ A+LLP ++    YF RRDVYDLHHA+LGLLYSVL+T V+TDAIK+AVGRPRPDFFWRCFPDGK
Sbjct:   50 RMREAQLGGHTLRSHGMTVARTHMHDWIILVLLVILECVLLIIHPFYRFVGKDMMTDLSYPLKSNTVPIWSVPVYAMLLPLVIFIFIYFRRRDVYDLHHAVLGLLYSVLVTAVLTDAIKNAVGRPRPDFFWRCFPDGK 187          
BLAST of FC868859 vs. ExPASy Swiss-Prot
Match: LPP1_ARATH (Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 5.771e-40
Identity = 77/138 (55.80%), Postives = 95/138 (68.84%), Query Frame = 3
Query:  222 KMPEIQLGAHTVRSHGLKVXXXXXXXXXXXXXXXXXXXXXXXXXPFHRFVGEDMMTDLRYPMKDNTVPFWAVPLIAILLPFIVVHVYYFIRRDVYDLHHAILGLLYSVLITGVITDAIKDAVGRPRPDFFWRCFPDGK 635
            +M EI L  HT++SHG +V                         PF+R+VG+DMMTDL+YP KDNTVP W+VP+ A+LLP IV   +Y  R  VYDLHH+ILGLL++VLITGVITD+IK A GRPRP+F+WRCFPDGK
Sbjct:   25 RMQEIDLSVHTIKSHGGRVASKHKHDWIILVILIAIEIGLNLISPFYRYVGKDMMTDLKYPFKDNTVPIWSVPVYAVLLPIIVFVCFYLKRTCVYDLHHSILGLLFAVLITGVITDSIKVATGRPRPNFYWRCFPDGK 162          
BLAST of FC868859 vs. ExPASy Swiss-Prot
Match: Y4367_DICDI (PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.628e-11
Identity = 35/90 (38.89%), Postives = 52/90 (57.78%), Query Frame = 3
Query:  354 PFHRFVGEDMMTD-----LRYPMKDNTVPFWAVPLIAILLPFIVVHVYYFIRRDVYDLHHAILGLLYSVLITGVITDAIKDAVGRPRPDF 608
            PF R+  E  ++      ++YP+  + VP W + LIA+ LP +V   YY   R+ +D HHA LGL  +  IT + TD +K + GR RPD+
Sbjct:   42 PFKRYEPESNISTNTFQLVQYPLLPDIVPVWLLMLIALGLPMVVFIGYYIKNRNSHDFHHAALGLFQAFTITMLFTDILKVSAGRYRPDY 131          
The following BLAST results are available for this feature:
BLAST of FC868859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LPP2_ARATH1.014e-5270.29Lipid phosphate phosphatase 2 OS=Arabidopsis thali... [more]
LPP3_ARATH2.957e-4460.14Putative lipid phosphate phosphatase 3, chloroplas... [more]
LPP1_ARATH5.771e-4055.80Lipid phosphate phosphatase 1 OS=Arabidopsis thali... [more]
Y4367_DICDI5.628e-1138.89PA-phosphatase related-family protein DDB_G0284367... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31005F12EF AbioticL1 Citrus clementina cDNA clone C31005F12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868859 ID=FC868859|Name=FC868859|organism=Citrus clementina|type=EST|length=652bp
GGAATTTTAAAAAATCGGAGTTCGTTACCTTACACAGCATTTAGAAGGTA
CAGTCCCCAGCTTCCCTCACAGTCACAGATGGAGTAATGAGCTCACTTGG
ACCCACCTCCAATCACTTGCTTTTGCTGGGGCTATAAAAATCAAATCTCC
TCTTCCGCACAGCGAAAGCAAAAACACACTCGCTTTTACTTGGTTTTCAG
AAATCCAAAAGAGATTAGTGAAAAATGCCTGAGATTCAGTTGGGTGCACA
TACTGTAAGATCCCATGGACTTAAAGTTCTAAAGCTACACATGCACGACT
GGCTGATTCTCTTGCTTCTTGGTGTAATAGAGATCATTTTGAATGTCATA
GAACCATTTCACCGCTTTGTTGGAGAGGATATGATGACAGATTTGAGATA
CCCTATGAAAGACAATACCGTTCCCTTTTGGGCTGTTCCATTGATTGCAA
TATTGCTCCCTTTTATTGTCGTGCATGTCTATTATTTCATCAGACGTGAT
GTATATGATCTGCACCATGCCATACTAGGCCTTCTATATTCTGTGCTCAT
TACTGGTGTTATAACTGATGCAATTAAAGATGCTGTTGGTCGTCCTCGCC
CAGATTTCTTTTGGCGGTGTTTTCCTGATGGTAAGGGGTCTTTGATAATG
TA
back to top