FC868861

Overview
NameFC868861
Unique NameFC868861
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length659
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9491 contig Ccv1_Contig9491:89..747. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: A115_TOBAC (Auxin-induced protein PCNT115 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.476e-75
Identity = 143/219 (65.30%), Postives = 168/219 (76.71%), Query Frame = 3
Query:   18 MAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDII-----VKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            MA+E  +VPR+KLG+QGLEVS  G GCM +S  Y  P  E D I +I HA + GIT  DT+DVYG + NE+LLGKALK   RE++++ATKFGI  +GD         V G P YVR+ CEASLKRLD+D IDLYYQHRVD  V IE T+GE+KKLVEEGK+KYIGLSEAS  TIRRAHAVHPI AVQ+EWSLW+RD+EE+IIP CRELGIGI  +SPLG
Sbjct:    1 MAKEGTKVPRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPEPDMIQLIHHAINSGITLLDTSDVYGPHTNEILLGKALKGGTRERVVLATKFGIV-LGDEKKAEGKRAVHGDPAYVRAACEASLKRLDIDCIDLYYQHRVDTRVPIEITVGELKKLVEEGKLKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDVEEEIIPTCRELGIGIVAYSPLG 218          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: IN22_MAIZE (IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 6.200e-74
Identity = 140/214 (65.42%), Postives = 161/214 (75.23%), Query Frame = 3
Query:   18 MAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPLG 659
            MA   + VPR+KLG+QGLEVS  G GCM +S  Y  P  E + I +I HA   G+TF DT+DVYG + NEVLLGKAL+   REK+ +ATKFG++   D    + G P YVR+ CE S KRL VD IDLYYQHR+DK V IE TIGE+KKLVEEGKIKYIGLSEAS  TIRRAHAVHPI AVQ+EWSLW+RD EEDIIP CRELGIGI  +SPLG
Sbjct:    1 MAAALVSVPRIKLGSQGLEVSAQGLGCMGMSAFYGPPKPESEMIKLIHHAVDAGVTFLDTSDVYGPHTNEVLLGKALQGGVREKVELATKFGVS-FADGKREIHGDPAYVRTACEGSFKRLGVDCIDLYYQHRIDKRVPIEVTIGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQLEWSLWSRDAEEDIIPTCRELGIGIVAYSPLG 213          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YAKC_SCHPO (Aldo-keto reductase yakc [NADP+] OS=Schizosaccharomyces pombe GN=yakc PE=1 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.180e-40
Identity = 95/214 (44.39%), Postives = 132/214 (61.68%), Query Frame = 3
Query:   33 LQVPRVKLGTQGLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREK-ILVATKFGIAGIGDT-DIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEE---DIIPLCRELGIGIXPFSPLG 659
            + +P  K+G     V  +GFGCM L   Y  P SEE    ++ HA   G TF+D++D+YG  ANE  +G+  KQ  R K I +ATKFG     +T ++ +   PDY+    + SLKRL +D IDLYY HR      IE+ +G +KK VE GKI+YIGLSE S +TIRRA AV+P++AVQ+E+S ++ +IE     ++  CRE  I I  ++PLG
Sbjct:    1 MSIPTRKIGND--TVPAIGFGCMGLHAMYG-PSSEEANQAVLTHAADLGCTFWDSSDMYGFGANEECIGRWFKQTGRRKEIFLATKFGYEKNPETGELSLNNEPDYIEKALDLSLKRLGIDCIDLYYVHRFSGETPIEKIMGALKKCVEAGKIRYIGLSECSANTIRRAAAVYPVSAVQVEYSPFSLEIERPEIGVMKACRENNITIVCYAPLG 211          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YCCK_BACSU (Uncharacterized oxidoreductase yccK OS=Bacillus subtilis GN=yccK PE=3 SV=2)

HSP 1 Score: 125.561 bits (314), Expect = 2.309e-28
Identity = 74/203 (36.45%), Postives = 115/203 (56.65%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLSGGYSSP-VSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLP-REKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            LG   L+V ++GFG   + G    P +++E G  +++ A   G+ F DTA +YG   +E L+G+ +++   R ++++ATK G     D  I +  S +++RS  E SLKRL  DYIDLYY H  D    + E  G +K+L +EGKIK IG S      ++  +A   +   Q E+SL  RD E++++P C + GI   P+ PL
Sbjct:    7 LGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTALDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATK-GAHKEVDGSIELDNSREFLRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQLQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPL 208          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: IOLS_BACSU (Protein iolS OS=Bacillus subtilis GN=iolS PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 3.938e-28
Identity = 67/205 (32.68%), Postives = 115/205 (56.10%), Query Frame = 3
Query:   45 RVKLGTQGLEVSKLGFGCMNLSGGYSSP-VSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            + KLG   L+V  +G G   + G    P ++EE G  +++ A   G+T  DTA +YG   +E L+G+ L++  RE +++ATK      G+ D +   SPD+++   + SLKRL+ DYIDL+Y H  D+    +E +  + ++ + GKI+ IG+S  S + ++ A+    +  +Q E++L  R+ E+   P  +E  I   P+ PL
Sbjct:    3 KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGIGRSEELIGEVLREFNREDVVIATKAAHRKQGN-DFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPL 206          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YDJG_ECOLI (Uncharacterized oxidoreductase ydjG OS=Escherichia coli (strain K12) GN=ydjG PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.146e-27
Identity = 74/218 (33.94%), Postives = 117/218 (53.67%), Query Frame = 3
Query:   45 RVKLGTQGLEVSKLGFGCMNLSGG--YSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAG---------IGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKS---VAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            ++ LGT  + +S++G G   + GG  ++  +  +  I  I  A   GI   DTA  Y    +EV++G+ALK+LPRE+++V TK GI           +GD  +    SP+ +R    ASL+RL +DYID+Y  H          I ET+  + +L  EGKI+ IG +    D IR       +  +Q ++S+  R +E +++PLCR+ GI +  +SPL
Sbjct:    3 KIPLGTTDITLSRMGLGTWAIGGGPAWNGDLDRQICIDTILEAHRCGINLIDTAPGYNFGNSEVIVGQALKKLPREQVVVETKCGIVWERKGSLFNKVGDRQLYKNLSPESIREEVAASLQRLGIDYIDIYMTHWQSVPPFFTPIAETVAVLNELKSEGKIRAIGAANVDADHIREYLQYGELDIIQAKYSILDRAMENELLPLCRDNGIVVQVYSPL 220          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: PLR1_SCHPO (Pyridoxal reductase OS=Schizosaccharomyces pombe GN=plr1 PE=1 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 6.287e-26
Identity = 73/203 (35.96%), Postives = 118/203 (58.13%), Query Frame = 3
Query:   66 GLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQN---ANEVLLGKALKQLPRE--KILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRL-DVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEED-IIPLCRELGIGIXPFSP 653
            G +V  +GFG M L+        +E+   ++ +A S+G  ++D  + YG +   +N  LL +  ++ P    K+ ++ K    G+    ++  G+PD+V    E  +  L     +DL+   RVD +V IE T+  +K  V+ GKI  +GLSE S +TI+RAHAV PIAAV++E+SL++RDIE + I+ +CR+L I I  +SP
Sbjct:    6 GFKVGPIGFGLMGLTWK-PKQTPDEEAFEVMNYALSQGSNYWDAGEFYGVDPPTSNLDLLARYFEKYPENANKVFLSVK---GGLDFKTLVPDGNPDFVSKSVENVIAHLRGTKKLDLFQCARVDPNVPIETTMKTLKGFVDSGKISCVGLSEVSAETIKRAHAVVPIAAVEVEYSLFSRDIETNGIMDICRKLSIPIIAYSP 204          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YH5B_SCHPO (Uncharacterized oxidoreductase C215.11c OS=Schizosaccharomyces pombe GN=SPBC215.11c PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.072e-25
Identity = 72/219 (32.88%), Postives = 119/219 (54.34%), Query Frame = 3
Query:    6 TSSNMAEEKLQVPRVKLGTQGLEVSKLGFGCMNLSGG--YSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            T+++ A +  Q   VK+G   + V+++GFG M ++G   +  P  +E  I  +K      I F DTAD YG   +E LL +AL   P + +++ATK G+   G  +    G+P ++R     S++RL V  IDL+  HR+D  V  ++   E+  + +EG I+++GLSE + D I+ A    P+ +VQ  ++L  R   E ++  C + GI   P+ PL
Sbjct:    4 TAASSAVDASQAGTVKVGD--MVVNRMGFGAMRVTGDGIWDEPKDKEACIATLKRLPELNINFIDTADSYGPEVSENLLREAL--YPYKGLIIATKGGLVRTGPNEWHPCGAPKFLRQEVLMSMRRLGVKQIDLWQLHRIDPKVPRKDQFSEIAAMKKEGLIRHVGLSEVTVDDIKEAEQYFPVVSVQNLFNLVNRK-NEKVLEYCEQKGIAFIPWYPL 217          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: YAJO_ECOLI (Uncharacterized oxidoreductase yajO OS=Escherichia coli (strain K12) GN=yajO PE=3 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 2.641e-24
Identity = 72/213 (33.80%), Postives = 116/213 (54.46%), Query Frame = 3
Query:   54 LGTQGLEVSKLGFGCMNLS----GGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQLPR-EKILVATKFGIAGIGDTDIIVKG-SPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSE------ASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRELGIGIXPFSPL 656
            LG   L VS+L  GCM       G ++  + EE    +IK A   GI FFDTA+ Y   ++E ++G+AL+   R E ++VATK     +GD   + +G S   +    + SL+RL +DY+D+   HR D +  IEET+  +  +V+ GK +YIG S       A    +++ H      ++Q  ++L  R+ E +++PLC + G+ + P+SPL
Sbjct:    6 LGKTDLRVSRLCLGCMTFGEPDRGNHAWTLPEESSRPIIKRALEGGINFFDTANSYSDGSSEEIVGRALRDFARREDVVVATKV-FHRVGD---LPEGLSRAQILRSIDDSLRRLGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASSMHASQFAQALELQKQHGWAQFVSMQDHYNLIYREEEREMLPLCYQEGVAVIPWSPL 214          
BLAST of FC868861 vs. ExPASy Swiss-Prot
Match: GS69_BACSU (General stress protein 69 OS=Bacillus subtilis GN=yhdN PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 4.505e-24
Identity = 65/187 (34.76%), Postives = 104/187 (55.61%), Query Frame = 3
Query:   66 GLEVSKLGFGCMNLSGGYSSPVSEEDGITMIKHAFSKGITFFDTADVYGQNANEVLLGKALKQL-PREKILVATKFGIAGIGDTDIIVKGSPDYVRSCCEASLKRLDVDYIDLYYQHRVDKSVAIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPIAAVQMEWSLWTRDIEEDIIPLCRE 623
            G+E S++G G   + G       E+  I  I+ A  +GIT  DTA  YG   +E ++GKA+K+   R+++++ATK  +    +  +    +   +    E SLKRL  DYIDLY  H  D  V IEET   MK+L + GKI+ IG+S  S + +    AV P+  +Q  ++L+ R++EE ++P  ++
Sbjct:   10 GIEASRIGLGTWAIGGTMWGGTDEKTSIETIRAALDQGITLIDTAPAYGFGQSEEIVGKAIKEYGKRDQVILATKTALDW-KNNQLFRHANRARIVEEVENSLKRLQTDYIDLYQVHWPDPLVPIEETAEVMKELYDAGKIRAIGVSNFSIEQMDTFRAVAPLHTIQPPYNLFEREMEESVLPYAKD 195          
The following BLAST results are available for this feature:
BLAST of FC868861 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
A115_TOBAC1.476e-7565.30Auxin-induced protein PCNT115 OS=Nicotiana tabacum... [more]
IN22_MAIZE6.200e-7465.42IN2-2 protein OS=Zea mays GN=IN2-2 PE=2 SV=1[more]
YAKC_SCHPO1.180e-4044.39Aldo-keto reductase yakc [NADP+] OS=Schizosaccharo... [more]
YCCK_BACSU2.309e-2836.45Uncharacterized oxidoreductase yccK OS=Bacillus su... [more]
IOLS_BACSU3.938e-2832.68Protein iolS OS=Bacillus subtilis GN=iolS PE=1 SV=... [more]
YDJG_ECOLI1.146e-2733.94Uncharacterized oxidoreductase ydjG OS=Escherichia... [more]
PLR1_SCHPO6.287e-2635.96Pyridoxal reductase OS=Schizosaccharomyces pombe G... [more]
YH5B_SCHPO1.072e-2532.88Uncharacterized oxidoreductase C215.11c OS=Schizos... [more]
YAJO_ECOLI2.641e-2433.80Uncharacterized oxidoreductase yajO OS=Escherichia... [more]
GS69_BACSU4.505e-2434.76General stress protein 69 OS=Bacillus subtilis GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31005G03EF AbioticL1 Citrus clementina cDNA clone C31005G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868861 ID=FC868861|Name=FC868861|organism=Citrus clementina|type=EST|length=659bp
AAACAACTTCCTCAAATATGGCAGAAGAGAAACTCCAAGTTCCAAGAGTG
AAACTGGGTACCCAAGGCCTTGAGGTTTCAAAATTGGGTTTTGGATGCAT
GAACCTGAGCGGAGGTTATAGCTCTCCAGTCTCAGAAGAGGACGGCATAA
CAATGATAAAGCATGCTTTCAGTAAAGGAATCACTTTCTTTGATACTGCT
GATGTTTACGGACAAAATGCTAATGAAGTTCTTCTTGGAAAGGCCTTGAA
GCAGTTGCCTAGAGAAAAGATACTAGTAGCAACGAAGTTTGGGATTGCAG
GAATAGGAGATACTGATATCATCGTGAAGGGTTCCCCTGATTATGTGCGC
TCGTGTTGTGAAGCTAGCTTGAAGCGTCTTGATGTGGATTACATTGATCT
ATATTATCAACATAGAGTGGACAAATCAGTTGCTATAGAGGAAACGATTG
GTGAAATGAAGAAGCTAGTGGAAGAGGGTAAAATCAAGTACATTGGATTA
TCTGAGGCTAGTCCAGACACAATTAGGAGAGCACATGCTGTTCATCCCAT
TGCAGCTGTACAAATGGAATGGTCCCTCTGGACTCGTGATATTGAGGAAG
ATATAATACCACTTTGCAGGGAACTTGGCATTGGAATAGNTCCATTCAGT
CCTCTTGGT
back to top