FC868966

Overview
NameFC868966
Unique NameFC868966
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length653
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSJ (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.160e-80
Identity = 144/186 (77.42%), Postives = 166/186 (89.25%), Query Frame = 3
Query:  108 PMQRLSQPAKRAVSTI----QSSVPATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            P   +++P+  +V ++     ++V   P+ + + +TLGRHLARRLVQIGATDVF+VPGDFNLTLLD+LIAEPGL LIGCCNELNAGYAADGYAR+RGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQT+TCYQAV+NNL+DAHE IDTA++T
Sbjct:    9 PSNGVAKPSCNSVGSLPVVSSNAVINPPVTSAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLLDYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAVINNLDDAHEQIDTAIAT 194          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC1_ORYSI (Pyruvate decarboxylase isozyme 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.160e-80
Identity = 144/186 (77.42%), Postives = 166/186 (89.25%), Query Frame = 3
Query:  108 PMQRLSQPAKRAVSTI----QSSVPATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            P   +++P+  +V ++     ++V   P+ + + +TLGRHLARRLVQIGATDVF+VPGDFNLTLLD+LIAEPGL LIGCCNELNAGYAADGYAR+RGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQT+TCYQAV+NNL+DAHE IDTA++T
Sbjct:    9 PSNGVAKPSCNSVGSLPVVSSNAVIHPPVTSAAGATLGRHLARRLVQIGATDVFAVPGDFNLTLLDYLIAEPGLKLIGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAVINNLDDAHEQIDTAIAT 194          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC1_MAIZE (Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PDC1 PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 2.585e-80
Identity = 140/175 (80.00%), Postives = 158/175 (90.29%), Query Frame = 3
Query:  129 PAKRAVSTIQSSVPATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            P   + + I +   A   + P+ +TLGRHLARRLVQIGA+DVF+VPGDFNLTLLD+LIAEPGL L+GCCNELNAGYAADGYARSRGVGAC VTFTVGGLSVLNAIAGAYSENLP++CIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQT+TCYQA++NNL+DAHE IDTA++T
Sbjct:   25 PVANSHAIIATPAAAAATLAPAGATLGRHLARRLVQIGASDVFAVPGDFNLTLLDYLIAEPGLTLVGCCNELNAGYAADGYARSRGVGACAVTFTVGGLSVLNAIAGAYSENLPVVCIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTITCYQAIINNLDDAHEQIDTAIAT 199          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC1_PEA (Pyruvate decarboxylase isozyme 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 8.316e-79
Identity = 138/165 (83.64%), Postives = 154/165 (93.33%), Query Frame = 3
Query:  159 SSVPATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            S++P  P  +  + T+GRHLARRLV+IG  DVFSVPGDFNLTLLDHLIAEP LNL+GCCNELNAGYAADGY R++GVGACVVTFTVGGLS+LNAIAGAYSENLP+ICIVGGPNSNDYGTNRILHHTIGLPDFSQEL+CFQT+TC+QAVVNNL+DAHELIDTA+ST
Sbjct:   20 SAIPLRP--SSCDGTMGRHLARRLVEIGVRDVFSVPGDFNLTLLDHLIAEPELNLVGCCNELNAGYAADGYGRAKGVGACVVTFTVGGLSILNAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELQCFQTITCFQAVVNNLDDAHELIDTAIST 182          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSJ (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.086e-78
Identity = 142/175 (81.14%), Postives = 156/175 (89.14%), Query Frame = 3
Query:  129 PAKRAVSTIQSSVPATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            PA      + S+ PA   V+  E++LGRHLARRLVQ+G +DVF+VPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADGYAR+RGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICI GGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTC+QAVV NLEDAHE IDTA++T
Sbjct:   23 PASAVGCPMTSARPAP--VSAGEASLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIAGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCHQAVVTNLEDAHEQIDTAIAT 195          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC2_ORYSI (Pyruvate decarboxylase isozyme 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2)

HSP 1 Score: 292.738 bits (748), Expect = 1.086e-78
Identity = 142/175 (81.14%), Postives = 156/175 (89.14%), Query Frame = 3
Query:  129 PAKRAVSTIQSSVPATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            PA      + S+ PA   V+  E++LGRHLARRLVQ+G +DVF+VPGDFNLTLLDHLIAEPGL L+GCCNELNAGYAADGYAR+RGVGAC VTFTVGGLSVLNAIAGAYSENLP+ICI GGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTC+QAVV NLEDAHE IDTA++T
Sbjct:   23 PASAVGCPMTSARPAP--VSAGEASLGRHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRLVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIAGAYSENLPVICIAGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCHQAVVTNLEDAHEQIDTAIAT 195          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC2_TOBAC (Pyruvate decarboxylase isozyme 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.418e-78
Identity = 143/172 (83.14%), Postives = 156/172 (90.70%), Query Frame = 3
Query:  138 RAVSTIQSSVPATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            +  S IQ S  ++ + N +++TLGRHLARRLV+IG  DVFSVPGDFNLTLLDHLIAEP L  IGCCNELNAGYAADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLP+ICIVGGPN+NDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNL+DAHE ID A+ST
Sbjct:    7 KGTSCIQDSQSSSVIAN-TDATLGRHLARRLVEIGIQDVFSVPGDFNLTLLDHLIAEPRLKNIGCCNELNAGYAADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPVICIVGGPNTNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLDDAHEQIDRAIST 177          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC3_ORYSJ (Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 2.265e-76
Identity = 134/161 (83.23%), Postives = 148/161 (91.93%), Query Frame = 3
Query:  171 ATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            A  + +  ++TLG HLARRLVQ+G +DVF+VPGDFNLTLLDHLIAEPGL ++GCCNELNAGYAADGYAR+RGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQ +TCYQAVVNNL+DAH+ ID A+ST
Sbjct:   15 AVVVPSSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQPLTCYQAVVNNLDDAHDQIDRAIST 175          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC3_ORYSI (Pyruvate decarboxylase isozyme 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=2 SV=2)

HSP 1 Score: 285.034 bits (728), Expect = 2.265e-76
Identity = 134/161 (83.23%), Postives = 148/161 (91.93%), Query Frame = 3
Query:  171 ATPLVNPSESTLGRHLARRLVQIGATDVFSVPGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            A  + +  ++TLG HLARRLVQ+G +DVF+VPGDFNLTLLDHLIAEPGL ++GCCNELNAGYAADGYAR+RGVGAC VTFTVGGLSVLNAI GAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQ +TCYQAVVNNL+DAH+ ID A+ST
Sbjct:   15 AVVVPSSGDATLGGHLARRLVQVGVSDVFAVPGDFNLTLLDHLIAEPGLRVVGCCNELNAGYAADGYARARGVGACAVTFTVGGLSVLNAIGGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQPLTCYQAVVNNLDDAHDQIDRAIST 175          
BLAST of FC868966 vs. ExPASy Swiss-Prot
Match: PDC1_TOBAC (Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.807e-49
Identity = 95/99 (95.96%), Postives = 97/99 (97.98%), Query Frame = 3
Query:  357 AADGYARSRGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVVNNLEDAHELIDTAVST 653
            AADGYAR+RGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGL DFSQE RCFQTVTCY+AVVNNLEDAHELIDTAVST
Sbjct:    1 AADGYARARGVGACVVTFTVGGLSVLNAIAGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLQDFSQEPRCFQTVTCYRAVVNNLEDAHELIDTAVST 99          
The following BLAST results are available for this feature:
BLAST of FC868966 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
PDC1_ORYSJ1.160e-8077.42Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]
PDC1_ORYSI1.160e-8077.42Pyruvate decarboxylase isozyme 1 OS=Oryza sativa s... [more]
PDC1_MAIZE2.585e-8080.00Pyruvate decarboxylase isozyme 1 OS=Zea mays GN=PD... [more]
PDC1_PEA8.316e-7983.64Pyruvate decarboxylase isozyme 1 OS=Pisum sativum ... [more]
PDC2_ORYSJ1.086e-7881.14Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC2_ORYSI1.086e-7881.14Pyruvate decarboxylase isozyme 2 OS=Oryza sativa s... [more]
PDC2_TOBAC1.418e-7883.14Pyruvate decarboxylase isozyme 2 OS=Nicotiana taba... [more]
PDC3_ORYSJ2.265e-7683.23Pyruvate decarboxylase isozyme 3 OS=Oryza sativa s... [more]
PDC3_ORYSI2.265e-7683.23Pyruvate decarboxylase isozyme 3 OS=Oryza sativa s... [more]
PDC1_TOBAC1.807e-4995.96Pyruvate decarboxylase isozyme 1 (Fragment) OS=Nic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007B01EF AbioticL1 Citrus clementina cDNA clone C31007B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868966 ID=FC868966; Name=FC868966; organism=Citrus clementina; type=EST; length=653bp
CTCAAAGACACNTTTTCGGAAACACATTAACAAACGGACAATTCTTCGTC
TCCGGCCCTTCAATCAATCATGGACACTAAAATTGGATCACTCGACACCT
GCAAGCCCCCATGCAGCGACTTAGCCAGCCCGCCAAACGTGCCGTTTCAA
CAATCCAATCCTCCGTTCCCGCTACTCCACTCGTCAACCCGTCCGAGTCG
ACCCTCGGCCGCCACCTCGCTCGCCGGCTCGTCCAAATCGGCGCCACCGA
CGTCTTCTCGGTCCCCGGCGACTTCAACTTGACGCTTCTCGACCACCTGA
TAGCCGAGCCCGGGCTCAACTTGATCGGTTGCTGTAACGAGCTGAATGCC
GGATACGCTGCCGATGGGTACGCTCGCTCGCGTGGGGTCGGCGCCTGTGT
CGTGACCTTCACCGTTGGTGGGCTTAGCGTGCTTAACGCTATCGCCGGTG
CTTACAGTGAAAATCTGCCGTTGATTTGCATCGTTGGTGGCCCAAACTCC
AATGATTACGGAACCAACAGGATCCTTCATCATACCATTGGCTTGCCTGA
TTTTAGCCAAGAACTCAGATGCTTTCAGACTGTCACCTGTTATCAGGCTG
TGGTGAATAACTTGGAGGATGCACATGAGTTGATTGATACGGCAGTATCA
ACT
back to top