FC868975

Overview
NameFC868975
Unique NameFC868975
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length696
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868975 vs. ExPASy Swiss-Prot
Match: ABA2_PRUAR (Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.218e-70
Identity = 138/220 (62.73%), Postives = 171/220 (77.73%), Query Frame = 3
Query:   48 MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGT-SGQSKNPTQMKAAVA---ESPTNNSDSENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKD 695
            M S++FYNS+NLS AVFSRTHFP+P+ K   +EFS   H  +Y  R+ T SGQ K  T+++A VA   E P+  + ++ KK                   K+KGF+V+VFEKD+SA+RGEGQYRGPIQIQSNALAALEAID+DVAEEVMR GCVTGDRINGLVDG+SG+WY+KFDTFTPA E+GLPVTRVISR+ LQQILA+AVG+EII+N+SNV++F+D
Sbjct:    1 MASTLFYNSMNLSAAVFSRTHFPIPINKDFPLEFSPCIHT-DYHLRSRTRSGQKKCLTEVRATVASPTEVPSAPASTQPKKLRILVAGGGIGGLVFALAAKKKGFDVVVFEKDLSAVRGEGQYRGPIQIQSNALAALEAIDMDVAEEVMRVGCVTGDRINGLVDGVSGTWYVKFDTFTPAVERGLPVTRVISRIALQQILARAVGEEIIINDSNVVNFED 219          
BLAST of FC868975 vs. ExPASy Swiss-Prot
Match: ABA2_SOLLC (Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 9.676e-60
Identity = 128/227 (56.39%), Postives = 157/227 (69.16%), Query Frame = 3
Query:   48 MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESP---TNNSDS--------ENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKD 695
            M S++FY SV+ ST+V SR   P+ + K    E      C + +   G   + K   ++KA +AE+P   T  +DS          KK                   K++GF+VLVFE+D+SAIRGEGQYRGPIQIQSNALAALEAIDLDVAE++M AGC+TG RINGLVDGISG+WY KFDTFTPA E+GLPVTRVISRMTLQQILA+AVG+EII+NESNV+DF+D
Sbjct:    1 MYSTVFYTSVHPSTSVLSRKQLPLLISKDFSAELYHSLPCRSLE--NGHINKVKG-VKVKATIAEAPVTPTEKTDSGANGDLKVPQKKLKVLVAGGGIGGLVFALAAKKRGFDVLVFERDLSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEDIMNAGCITGQRINGLVDGISGNWYCKFDTFTPAVERGLPVTRVISRMTLQQILARAVGEEIIMNESNVVDFED 224          
BLAST of FC868975 vs. ExPASy Swiss-Prot
Match: ABA2_NICPL (Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 5.309e-58
Identity = 123/222 (55.41%), Postives = 154/222 (69.37%), Query Frame = 3
Query:   48 MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQM-KAAVAESP-----TNNSDSENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKD 695
            M S++FY SV+ ST+ FSR   P+ + K    E      C     R+  +GQ K    + KA +AE+P     T+      KK                   K++GF+VLVFE+D+SAIRGEGQYRGPIQIQSNALAALEAID+DVAE++M AGC+TG RINGLVDG+SG+WY KFDTFTPA E+GLPVTRVISRMTLQQ LA+AVG++II+NESNV++F+D
Sbjct:    1 MYSTVFYTSVHPSTSAFSRKQLPLLISKDFPTELYHSLPCS----RSLENGQIKKVKGVVKATIAEAPATIPPTDLKKVPQKKLKVLVAGGGIGGLVFALAAKKRGFDVLVFERDLSAIRGEGQYRGPIQIQSNALAALEAIDMDVAEDIMNAGCITGQRINGLVDGVSGNWYCKFDTFTPAVERGLPVTRVISRMTLQQNLARAVGEDIIMNESNVVNFED 218          
BLAST of FC868975 vs. ExPASy Swiss-Prot
Match: ABA2_CAPAN (Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.353e-53
Identity = 106/172 (61.63%), Postives = 130/172 (75.58%), Query Frame = 3
Query:  195 SGQSKNPTQMKAAVAESPT-----NNSDSENKKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKD 695
            +G  K    +KA +AE+P      +NS+   KK                   K++GF+VLVFE+D+SAIRGEGQYRGPIQIQSNALAALEAID+DVAEE+M AGC+TG RINGLVDGISG+WY KFDTFTPA E+GLPVTRVISRMTLQQILA+  G+++I+NES+V++F D
Sbjct:   45 NGHIKKVKGVKATLAEAPATPTEKSNSEVPQKKLKVLVAGGGIGGLVFALAGKKRGFDVLVFERDISAIRGEGQYRGPIQIQSNALAALEAIDMDVAEEIMNAGCITGQRINGLVDGISGNWYCKFDTFTPAVERGLPVTRVISRMTLQQILARLQGEDVIMNESHVVNFAD 216          
The following BLAST results are available for this feature:
BLAST of FC868975 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ABA2_PRUAR1.218e-7062.73Zeaxanthin epoxidase, chloroplastic OS=Prunus arme... [more]
ABA2_SOLLC9.676e-6056.39Zeaxanthin epoxidase, chloroplastic OS=Solanum lyc... [more]
ABA2_NICPL5.309e-5855.41Zeaxanthin epoxidase, chloroplastic OS=Nicotiana p... [more]
ABA2_CAPAN1.353e-5361.63Zeaxanthin epoxidase, chloroplastic OS=Capsicum an... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007B10EF AbioticL1 Citrus clementina cDNA clone C31007B10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868975 ID=FC868975; Name=FC868975; organism=Citrus clementina; type=EST; length=696bp
GCCGAGGAGGGGAGAACACTGCCGAAAGAAGCCGTTGGAGAAACAAGATG
GTTTCATCTATGTTCTACAATTCAGTCAATCTTTCAACAGCTGTTTTCTC
AAGAACCCACTTCCCAGTTCCTGTATACAAACATTCTTGCATTGAATTTT
CACGTTATGATCACTGTATTAACTACAAATTCAGGACCGGAACAAGTGGG
CAAAGCAAGAACCCGACACAAATGAAAGCTGCAGTGGCAGAGTCCCCTAC
TAATAACAGTGACAGTGAAAACAAGAAATTGAGGATTTTGGTGGCTGGTG
GTGGGATTGGAGGACTTGTATTTGCTTTGGCTGCTAAAAGGAAAGGATTT
GAAGTGCTGGTGTTTGAGAAAGATATGAGTGCTATAAGAGGTGAGGGACA
ATACAGAGGTCCAATTCAGATACAAAGCAATGCATTGGCTGCTTTGGAAG
CTATTGATTTGGATGTTGCTGAGGAAGTTATGAGAGCTGGATGTGTTACC
GGTGATAGAATTAATGGTTTGGTTGATGGGATTTCTGGTTCTTGGTACAT
CAAGTTTGATACTTTCACTCCTGCAGCAGAAAAGGGACTGCCAGTCACAA
GAGTAATTAGCCGAATGACTTTGCAACAAATACTAGCTAAAGCGGTTGGG
GATGAAATCATTTTGAATGAAAGTAATGTTATTGATTTTAAGGATC
back to top