FC868984

Overview
NameFC868984
Unique NameFC868984
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868984 vs. ExPASy Swiss-Prot
Match: MPU1_ARATH (Mannose-P-dolichol utilization defect 1 protein homolog OS=Arabidopsis thaliana GN=At5g59470 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 3.445e-62
Identity = 105/169 (62.13%), Postives = 135/169 (79.88%), Query Frame = 1
Query:  175 MDYLGINIGCVTGSLRDGKFPEKDCLLPLLSKVLGYLIVALSTTVKLPQILKILKHRSASGISATTFELEVVAATIGLGYSIQKGIPFSAYGEVFFILIQGLILVAITYYYSQPVGTATWIRALLYCAIAPTILAGQINPVLFETIYAFQHITFLSARIPQIWKNFKTK 681
            MDYLGI++ C  GSLR+G+FP KDCLLPL+SK+LGY +VA S TVKLPQI+KI+ ++S  G+S   FELEV+  TI L Y + K +PFSA+GE+ F+LIQ LILVA  YY+SQP+   TW++A+LY AIAPT+ AG+I+P LFE +YA +H+ FLSARIPQIWKNF+ K
Sbjct:    1 MDYLGIDLSCAIGSLRNGEFPAKDCLLPLISKLLGYFLVAASMTVKLPQIMKIVDNKSVKGLSVVAFELEVIGYTISLAYCLNKDLPFSAFGELAFLLIQALILVACIYYFSQPLSVTTWVKAILYFAIAPTVFAGKIDPFLFEALYASKHLIFLSARIPQIWKNFRNK 169          

HSP 2 Score: 30.4166 bits (67), Expect = 3.445e-62
Identity = 13/13 (100.00%), Postives = 13/13 (100.00%), Query Frame = 3
Query:  675 NKSTGQLSFLTCL 713
            NKSTGQLSFLTCL
Sbjct:  168 NKSTGQLSFLTCL 180          
BLAST of FC868984 vs. ExPASy Swiss-Prot
Match: MPU1_HUMAN (Mannose-P-dolichol utilization defect 1 protein OS=Homo sapiens GN=MPDU1 PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.069e-12
Identity = 40/87 (45.98%), Postives = 55/87 (63.22%), Query Frame = 1
Query:  247 CLLPLLSKVLGYLIVALSTTVKLPQILKILKHRSASGISATTFELEVVAATIGLGYSIQKGIPFSAYGEVFFILIQGLILVAITYYY 507
            CL  LLSK LG  IVA S  VKLPQ+ KIL  +SA G+S  +  LE+VA T  + YSI    PFS++GE  F+++Q + +  +  +Y
Sbjct:   37 CLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHY 123          
BLAST of FC868984 vs. ExPASy Swiss-Prot
Match: MPU1_CRIGR (Mannose-P-dolichol utilization defect 1 protein OS=Cricetulus griseus GN=MPDU1 PE=2 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.702e-12
Identity = 45/117 (38.46%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  247 CLLPLLSKVLGYLIVALSTTVKLPQILKILKHRSASGISATTFELEVVAATIGLGYSIQKGIPFSAYGEVFFILIQGLILVAITYYYSQPVGTATWIRALLYCAIAPTILAGQINPV 597
            CL  LLSK LG  IVA S  VKLPQI KIL  +SA G+S  +  LE+VA T  + YSI    PFS++GE  F+ +Q + +  +  +Y         ++ +   A   T+L   ++P+
Sbjct:   37 CLKILLSKGLGLGIVAGSLLVKLPQIFKILGAKSAEGLSLQSVMLELVALTGTVIYSITNNFPFSSWGEALFLTLQTITICLLVLHY-----RGDTVKGVALLACYATLLLALLSPL 148          
BLAST of FC868984 vs. ExPASy Swiss-Prot
Match: MPU1_MOUSE (Mannose-P-dolichol utilization defect 1 protein OS=Mus musculus GN=Mpdu1 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.027e-11
Identity = 42/117 (35.90%), Postives = 65/117 (55.56%), Query Frame = 1
Query:  247 CLLPLLSKVLGYLIVALSTTVKLPQILKILKHRSASGISATTFELEVVAATIGLGYSIQKGIPFSAYGEVFFILIQGLILVAITYYYSQPVGTATWIRALLYCAIAPTILAGQINPV 597
            CL  LLSK LG  IVA S  VKLPQ+ K+L  +SA G+S  +  LE+VA T  + YSI    PFS++GE  F+ +Q + +  +  +Y         ++ + + A    +L   ++P+
Sbjct:   37 CLKILLSKGLGLGIVAGSLLVKLPQVFKLLGAKSAEGLSLQSVMLELVALTGTVVYSITNNFPFSSWGEALFLTLQTVAICFLVMHY-----RGETVKGVAFLACYAMVLLALLSPL 148          
BLAST of FC868984 vs. ExPASy Swiss-Prot
Match: MPU1_DROME (Mannose-P-dolichol utilization defect 1 protein homolog OS=Drosophila melanogaster GN=CG3792 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.751e-11
Identity = 35/93 (37.63%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  232 FPEKDCLLPLLSKVLGYLIVALSTTVKLPQILKILKHRSASGISATTFELEVVAATIGLGYSIQKGIPFSAYGEVFFILIQGLILVAITYYYS 510
            F +  C   LLSK LG  I+A S  VK+PQ+LKIL  +S  GI+     L+++A +  L Y+   G PFSA+G+  F+ IQ + +  +  +++
Sbjct:   27 FLDVPCFKALLSKGLGLAIIAGSVLVKVPQVLKILNSKSGEGINIVGVVLDLLAISFHLSYNFMHGYPFSAWGDSTFLAIQTVTIAVLVLFFN 119          
The following BLAST results are available for this feature:
BLAST of FC868984 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
MPU1_ARATH3.445e-6262.13Mannose-P-dolichol utilization defect 1 protein ho... [more]
MPU1_HUMAN2.069e-1245.98Mannose-P-dolichol utilization defect 1 protein OS... [more]
MPU1_CRIGR2.702e-1238.46Mannose-P-dolichol utilization defect 1 protein OS... [more]
MPU1_MOUSE1.027e-1135.90Mannose-P-dolichol utilization defect 1 protein OS... [more]
MPU1_DROME1.751e-1137.63Mannose-P-dolichol utilization defect 1 protein ho... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007C07EF AbioticL1 Citrus clementina cDNA clone C31007C07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868984 ID=FC868984; Name=FC868984; organism=Citrus clementina; type=EST; length=714bp
CGGGGGAAAGTGGAGTGTGCTGTCATCACTTTGGTCCTTTGAAGGCAGTT
GCTACTTGCTACTTTGCTAGTAATAAAATAATACAATATAATATAAACGT
TGCTGTAGTTGTTGTTGAATTGTAATTGGAATTTGATTGAATTCCATAAT
TCAAAAGAAAAAAAAGAGGGGGCCATGGATTATCTAGGGATTAACATTGG
CTGCGTGACCGGATCTCTGCGAGATGGCAAATTTCCAGAGAAAGATTGTT
TGCTGCCTCTCCTTTCGAAGGTCCTCGGCTACTTAATCGTCGCCCTCTCC
ACTACCGTCAAACTCCCTCAGATATTGAAAATCTTGAAGCATAGAAGTGC
AAGTGGGATTAGCGCCACTACCTTCGAGCTTGAAGTAGTTGCGGCTACTA
TTGGTCTGGGGTATTCTATTCAGAAAGGGATTCCCTTTTCAGCTTATGGG
GAGGTGTTCTTTATTTTGATCCAAGGATTAATTTTAGTTGCTATAACTTA
CTACTATTCACAACCTGTTGGTACCGCAACGTGGATCAGGGCACTGCTAT
ATTGTGCTATAGCACCAACCATTTTAGCTGGTCAAATTAATCCCGTTCTT
TTTGAAACTATATATGCATTCCAGCATATCACATTTTTATCTGCCAGGAT
CCCTCAAATATGGAAGAACTTTAAAACAAAAGTACTGGACAGCTCAGCTT
CTTGACATGTCTCA
back to top