FC868987

Overview
NameFC868987
Unique NameFC868987
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: P2C57_ARATH (Protein phosphatase 2C 57 OS=Arabidopsis thaliana GN=PPH1 PE=2 SV=2)

HSP 1 Score: 248.054 bits (632), Expect = 3.521e-65
Identity = 130/225 (57.78%), Postives = 162/225 (72.00%), Query Frame = 3
Query:   39 MALLNQQLQRFLLTRLNYNFKPTVKNN---LVNTTTARAKSQCYCSAIAIDAPSSFSGVAGIRWGSVSLQGLREEMEDGAVIQSDGLDGFSFAAVFDGHGGVSTVKFLRDELYKECVAALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNA-EEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGGWI 701
            MALL   L RF    L ++  P+       +V  T  R +    CSAIAIDAPSS +GV  IRWG  S+QG R+EMED  VI+SD +D FS+AAVFDGH G S+VKFLR+ELYKECV ALQ G LL+G DF AIK+ L +AFE+ D  LL WLE N  EEDESG+TATV+ I  D+ FI+HIGD C VLSR+G+ + LT+ HRPYGSS+ ++QE++R++EAGGWI
Sbjct:    1 MALLRPHLHRFHSNTLRHSAYPSADAGGGLVVYPTYGRHR----CSAIAIDAPSSLTGVTPIRWGYTSVQGFRDEMEDDIVIRSDAVDSFSYAAVFDGHAGSSSVKFLREELYKECVGALQAGSLLNGGDFAAIKEALIKAFESVDRNLLKWLEANGDEEDESGSTATVMIIRNDVSFIAHIGDSCAVLSRSGQIEELTDYHRPYGSSRAAIQEVKRVKEAGGWI 221          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: P2C05_ORYSJ (Probable protein phosphatase 2C 5 OS=Oryza sativa subsp. japonica GN=Os01g0552300 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 8.994e-53
Identity = 107/190 (56.32%), Postives = 132/190 (69.47%), Query Frame = 3
Query:  141 RAKSQCYCSAIAIDA-PSSFSGVAGIRWGSVSLQGLREEMEDGAVIQSDGL-DGFSFAAVFDGHGGVSTVKFLRDELYKECVAALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCV-VLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGGWI 701
            RA S  +C A A  +  SS S +  IRWG+  LQG R+EMED  V++   L DGFSFAAVFDGH G S V+FLRDELYKEC AAL GG +LS K+ DAI   +Q AF   D  L  WLE   +EDESGATAT +F+  D+L +SHIGD C+ V+SR G+   +TN HRPYG+ + SL+E++RIR AGGWI
Sbjct:   31 RAGSAAWCHASAAGSVASSSSELEAIRWGTAKLQGARDEMEDEVVLRPGSLLDGFSFAAVFDGHAGFSAVEFLRDELYKECAAALDGGAVLSTKNLDAITDSIQRAFATVDANLSTWLEQMDKEDESGATATAMFLRNDVLVVSHIGDSCLQVVSRGGRPQAVTNFHRPYGNKKASLEEVKRIRAAGGWI 220          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: P2C11_ARATH (Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 8.793e-16
Identity = 62/184 (33.70%), Postives = 97/184 (52.72%), Query Frame = 3
Query:  174 AIDAPSSFSGVAGIR-----WGSVSLQGLREEMEDGAVIQSDGLDG--FSFAAVFDGHGGVSTVKFLRDELYKECVAALQGGLLLSGKDFDA-IKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGGWI 701
            A+ +    S +AG+R     +G  SL+G R  MED    +   ++G   +F  VFDGHGG  T ++L++ L+K          L+S  DF +  KK + E F+  D + L  +E   +   +G+TA   F+  D L ++++GD  VV SR G A  L++ H+P  S      E +RI +AGG+I
Sbjct:  104 ALFSGGGISFLAGVRTVKFSYGYSSLKGKRATMEDYFETRISDVNGQMVAFFGVFDGHGGARTAEYLKNNLFKN---------LVSHDDFISDTKKAIVEVFKQTDEEYL--IEEAGQPKNAGSTAATAFLIGDKLIVANVGDSRVVASRNGSAVPLSDDHKPDRS-----DERQRIEDAGGFI 271          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: PPMBL_MOUSE (Probable protein phosphatase 1B-like OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.075e-13
Identity = 54/171 (31.58%), Postives = 87/171 (50.88%), Query Frame = 3
Query:  198 SGVAGIRWGSVSLQGLREEMEDG--AVIQSDGL-DGFSFAAVFDGHGGVSTVKFLRDELYKECVAALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGGWI 701
            +  +G+R+G+ ++QG R  MED   A +   GL  G++F AV DGHGG    +F    L       + G L  + ++ D +++ L+ AF  AD +L     +    D  G+TA  + +    L+++H GD   +LSR+G     T  HRP+       +E  RI +AGG +
Sbjct:   53 AATSGLRFGASAVQGWRARMEDAHCARLALPGLPSGWAFFAVLDGHGGARAARFGARHL----PGYVLGELGPAPQEPDGVRQALRSAFLQADAQLS---ALWPRGDPGGSTAVALLVSPRFLYLAHCGDSRALLSRSGSVAFCTEDHRPHRP-----RERERIHDAGGTV 211          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: P2C69_ARATH (Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.075e-13
Identity = 52/180 (28.89%), Postives = 88/180 (48.89%), Query Frame = 3
Query:  177 IDAPSSFSGVAG---IRWGSVSLQGLREEMEDGAVIQSDGLDG--FSFAAVFDGHGGVSTVKFLRDELYKECVAALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGGWI 701
            ++AP+S  G++      +G  S  G R  MED    + DG++G       VFDGHGG    ++++  L+          L+   K     K  + +A+ + D +LL     N+   ++G+TA+   +  D L ++++GD   V+SR GKA  ++  H+P  S      E  RI  AGG++
Sbjct:   17 VEAPASGGGLSQNGKFSYGYASSAGKRSSMEDFFETRIDGINGEIVGLFGVFDGHGGARAAEYVKRHLFSN--------LITHPKFISDTKSAITDAYNHTDSELLK--SENSHNRDAGSTASTAILVGDRLVVANVGDSRAVISRGGKAIAVSRDHKPDQS-----DERERIENAGGFV 181          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: PPM1B_MOUSE (Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.335e-13
Identity = 55/171 (32.16%), Postives = 82/171 (47.95%), Query Frame = 3
Query:  210 GIRWGSVSLQGLREEMEDG--AVIQ-SDGLDGFSFAAVFDGHGGVSTVKFLRDELYKECV------AALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGG 695
            G+R+G  S+QG R EMED   AV+    GLD +SF AV+DGH G     +    L +         AA + G  L     +++K G++  F   D  + N+ ++    D SG+TA  V +    ++  + GD   VL R G+    T  H+P      +  E  RI+ AGG
Sbjct:   21 GLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALE-PSVESVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKP-----CNPVEKERIQNAGG 185          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: P2C71_ARATH (Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.099e-13
Identity = 51/180 (28.33%), Postives = 86/180 (47.78%), Query Frame = 3
Query:  177 IDAPSSFSGVAG---IRWGSVSLQGLREEMEDGAVIQSDGLDG--FSFAAVFDGHGGVSTVKFLRDELYKECVAALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGGWI 701
            ++AP+S  G++      +G  S  G R  MED    + DG+DG       VFDGHGG    ++++  L+          L+   K     K  + +A+ + D +LL     N+   ++G+TA+   +  D L ++++GD   V+ R G A  ++  H+P  S      E  RI  AGG++
Sbjct:   17 VEAPASGGGLSQNGKFSYGYASSAGKRSSMEDFFETRIDGIDGEIVGLFGVFDGHGGSRAAEYVKRHLFSN--------LITHPKFISDTKSAIADAYTHTDSELLK--SENSHTRDAGSTASTAILVGDRLLVANVGDSRAVICRGGNAFAVSRDHKPDQS-----DERERIENAGGFV 181          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: PPM1B_RAT (Protein phosphatase 1B OS=Rattus norvegicus GN=Ppm1b PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.188e-12
Identity = 55/171 (32.16%), Postives = 81/171 (47.37%), Query Frame = 3
Query:  210 GIRWGSVSLQGLREEMEDG--AVIQ-SDGLDGFSFAAVFDGHGGVSTVKFLRDELYKECV------AALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGG 695
            G+R+G  S+QG R EMED   AV+    GL+ +SF AV+DGH G     +    L +         AA + G  L     + +K G++  F   D  + N+ ++    D SG+TA  V I    ++  + GD   VL R G+    T  H+P      +  E  RI+ AGG
Sbjct:   21 GLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITTNEDFRAADKSGFALE-PSVENVKTGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPTHIYFINCGDSRAVLCRNGQVCFSTQDHKP-----CNPMEKERIQNAGG 185          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: PPM1B_BOVIN (Protein phosphatase 1B OS=Bos taurus GN=PPM1B PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.188e-12
Identity = 55/171 (32.16%), Postives = 83/171 (48.54%), Query Frame = 3
Query:  210 GIRWGSVSLQGLREEMEDG--AVIQ-SDGLDGFSFAAVFDGHGGVSTVKFLRDELYKECV------AALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGG 695
            G+R+G  S+QG R EMED   AV+    GL+ +SF AV+DGH G     +    L +         AA + G  L     + +K G++  F   D  + N+ ++    D SG+TA  V I    ++  + GD   VL R+G+    T  H+P      + +E  RI+ AGG
Sbjct:   21 GLRYGLSSMQGWRVEMEDAHTAVVGIPHGLEDWSFFAVYDGHAGSRVANYCSTHLLEHITNNEDFRAAGKSGSALE-PSVENVKNGIRTGFLKIDEYMRNFSDLRNGMDRSGSTAVGVMISPKHIYFINCGDSRAVLYRSGQVCFSTQDHKP-----CNPREKERIQNAGG 185          
BLAST of FC868987 vs. ExPASy Swiss-Prot
Match: P2C59_ORYSJ (Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.188e-12
Identity = 51/171 (29.82%), Postives = 80/171 (46.78%), Query Frame = 3
Query:  195 FSGVAGIRWGSVSLQGLREEMEDGAVIQSDGLDGFSFA--AVFDGHGGVSTVKFLRDELYKECVAALQGGLLLSGKDFDAIKKGLQEAFENADMKLLNWLEMNAEEDESGATATVVFIGRDILFISHIGDCCVVLSRTGKADVLTNPHRPYGSSQVSLQEIRRIREAGGWI 701
            FS      +G  S  G R  MED    + DG+DG +     VFDGHGG    +F++  L+          L+   K F   K  + E + + D +LL   E +   D     +T + +G D L ++++GD   V+ R G A  ++  H+P  S      E +RI +AGG++
Sbjct:   57 FSANGKFSYGYASSPGKRSSMEDFYDTRIDGVDGETVGLFGVFDGHGGARAAEFVKQNLFTN--------LIKHPKLFSDTKSAIAETYTSTDSELLK-AETSHNRDAGSTASTAILVG-DRLLVANVGDSRAVICRGGDAIAVSRDHKPDQS-----DERQRIEDAGGFV 212          
The following BLAST results are available for this feature:
BLAST of FC868987 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
P2C57_ARATH3.521e-6557.78Protein phosphatase 2C 57 OS=Arabidopsis thaliana ... [more]
P2C05_ORYSJ8.994e-5356.32Probable protein phosphatase 2C 5 OS=Oryza sativa ... [more]
P2C11_ARATH8.793e-1633.70Probable protein phosphatase 2C 11 OS=Arabidopsis ... [more]
PPMBL_MOUSE1.075e-1331.58Probable protein phosphatase 1B-like OS=Mus muscul... [more]
P2C69_ARATH1.075e-1328.89Probable protein phosphatase 2C 69 OS=Arabidopsis ... [more]
PPM1B_MOUSE5.335e-1332.16Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE... [more]
P2C71_ARATH9.099e-1328.33Probable protein phosphatase 2C 71 OS=Arabidopsis ... [more]
PPM1B_RAT1.188e-1232.16Protein phosphatase 1B OS=Rattus norvegicus GN=Ppm... [more]
PPM1B_BOVIN1.188e-1232.16Protein phosphatase 1B OS=Bos taurus GN=PPM1B PE=2... [more]
P2C59_ORYSJ1.188e-1229.82Probable protein phosphatase 2C 59 OS=Oryza sativa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007C10EF AbioticL1 Citrus clementina cDNA clone C31007C10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868987 ID=FC868987; Name=FC868987; organism=Citrus clementina; type=EST; length=705bp
GGAACTCACTCCTTCAAACTCGCTGAGTCAGTCAATTAATGGCGTTGCTG
AACCAACAGTTACAGAGGTTTCTCTTAACAAGGCTCAACTATAACTTCAA
GCCCACCGTCAAAAACAACCTTGTCAATACAACAACAGCAAGAGCTAAAA
GCCAGTGCTACTGCTCGGCGATTGCAATAGACGCGCCGTCTTCGTTCAGT
GGTGTTGCCGGAATCCGATGGGGGTCTGTAAGTTTACAGGGCCTACGTGA
GGAAATGGAGGATGGTGCTGTTATTCAATCGGATGGCCTTGATGGGTTCT
CTTTTGCAGCTGTTTTTGATGGCCATGGTGGAGTCTCTACTGTCAAGTTT
CTTAGGGATGAGCTATACAAAGAATGTGTTGCAGCTTTACAAGGAGGATT
GCTGTTGAGTGGAAAAGATTTTGATGCCATTAAGAAGGGATTACAGGAGG
CTTTTGAAAATGCTGATATGAAATTGTTGAATTGGCTTGAAATGAATGCG
GAGGAGGATGAATCTGGTGCAACCGCTACTGTTGTGTTCATTGGAAGGGA
TATTTTGTTCATCTCACATATTGGTGACTGTTGTGTGGTTCTATCTCGTA
CTGGAAAAGCAGATGTATTGACTAATCCTCATCGGCCTTATGGAAGCAGC
CAGGTCTCACTTCAGGAAATTAGAAGAATCAGAGAAGCGGGCGGATGGAT
TTCCA
back to top