FC868990

Overview
NameFC868990
Unique NameFC868990
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5260 contig Ccv1_Contig5260:24..699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868990 vs. ExPASy Swiss-Prot
Match: GI1L3_ARATH (Probable gibberellin receptor GID1L3 OS=Arabidopsis thaliana GN=GID1L3 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.022e-19
Identity = 68/221 (30.77%), Postives = 95/221 (42.99%), Query Frame = 1
Query:   43 DGTITRDYSNYPSTTATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKL---------PLIVYVHGGGLILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALEVLHWIKTTQEHWLIQYAD-L*SCFIMGDSGGGNVAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILLPSSTDLLWQLALP 675
            DGT  R  + +       + N      S DV +++      R++ P  A  S + T L         P+IV+ HGG     SA + IY  LC  +     AV+VSV+YR APE+R P AY D   VL W+ ++   WL    D     F+ GDS GGN+ ++                          FGG +RTESE RL  +  +     D  W+  LP
Sbjct:   38 DGTFNRHLAEFLDRKVPANANPVNGVFSFDVIIDRQTNLLSRVYRPADAGTSPSITDLQNPVDGEIVPVIVFFHGGSFAHSSANSAIYDTLCRRLVGLCGAVVVSVNYRRAPENRYPCAYDDGWAVLKWVNSSS--WLRSKKDSKVRIFLAGDSSGGNIVHN-----VAVRAVESRIDVLGNILLNPMFGGTERTESEKRLDGKYFVTVRDRDWYWRAFLP 251          
BLAST of FC868990 vs. ExPASy Swiss-Prot
Match: GID1_ORYSJ (Gibberellin receptor GID1 OS=Oryza sativa subsp. japonica GN=GID1 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.696e-18
Identity = 69/235 (29.36%), Postives = 98/235 (41.70%), Query Frame = 1
Query:   28 VIVNADGTITRDYSNYPSTTATPDPNDHTIAVSKDVPVNQSNKTWVRIF--------------LPRQAL----DSSTKTKLPLIVYVHGGGLILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALEVLHWIKTTQEHWLIQYADL*S-CFIMGDSGGGNVAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILLPSSTDLLWQLALP 675
            ++  ADGT  RD   Y       +        S D  ++QS    VRI+              + R  L    D+      P+I++ HGG  +  SA++ IY  LC         V+VSV+YR APEHR P AY D    L W+ +  + ++    D  +  F+ GDS GGN+A+H                          FGG +RTESE RL  +  +     D  W+  LP
Sbjct:   33 ILRRADGTFERDLGEYLDRRVPANARPLEGVSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILEFLTDAPAAEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMS--QPFMRSGGDAQARVFLSGDSSGGNIAHH-----VAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLP 260          
BLAST of FC868990 vs. ExPASy Swiss-Prot
Match: GI1L1_ARATH (Probable gibberellin receptor GID1L1 OS=Arabidopsis thaliana GN=GID1L1 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.388e-15
Identity = 64/228 (28.07%), Postives = 93/228 (40.79%), Query Frame = 1
Query:   28 VIVNADGTITRDYSNYPSTTATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDSSTKTKL-----------PLIVYVHGGGLILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALEVLHWIKTTQEHWLIQYAD-L*SCFIMGDSGGGNVAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILLPSSTDLLWQLALP 675
            ++   DGT  R  + Y     T + N      S DV +++      R++ P  A      + L           P+I++ HGG     SA + IY  LC  +      V+VSV+YR APE+  P AY D    L+W+ +    WL    D     F+ GDS GGN+A++                          FGG +RTESE  L  +  +     D  W+  LP
Sbjct:   33 ILRRPDGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNS--RSWLKSKKDSKVHIFLAGDSSGGNIAHN-----VALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLP 253          
BLAST of FC868990 vs. ExPASy Swiss-Prot
Match: GI1L2_ARATH (Probable gibberellin receptor GID1L2 OS=Arabidopsis thaliana GN=GID1L2 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.368e-15
Identity = 64/231 (27.71%), Postives = 94/231 (40.69%), Query Frame = 1
Query:   28 VIVNADGTITRDYSNY--PSTTATPDPNDHTIAVSKDVPVNQSNKTWVRIFLPRQALDS------------STKTKLPLIVYVHGGGLILLSAATKIYHDLCSDIAARVPAVIVSVDYRLAPEHRLPAAYYDALEVLHWIKTTQEHWLIQYADL-*SCFIMGDSGGGNVAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILLPSSTDLLWQLALP 675
            V+   DG+  RD + +      A   P D   +      V+ +     RI+ P   L              ST   +P++++ HGG     SA + IY   C  +      V+VSVDYR +PEHR P AY D    L+W+K+    WL    D     ++ GDS GGN+A++                          FGG +RT+SE  L  +  +     D  W+  LP
Sbjct:   33 VLRRPDGSFNRDLAEFLDRKVPANSFPLDGVFSFDH---VDSTTNLLTRIYQPASLLHQTRHGTLELTKPLSTTEIVPVLIFFHGGSFTHSSANSAIYDTFCRRLVTICGVVVVSVDYRRSPEHRYPCAYDDGWNALNWVKS--RVWLQSGKDSNVYVYLAGDSSGGNIAHN-----VAVRATNEGVKVLGNILLHPMFGGQERTQSEKTLDGKYFVTIQDRDWYWRAYLP 253          
The following BLAST results are available for this feature:
BLAST of FC868990 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
GI1L3_ARATH6.022e-1930.77Probable gibberellin receptor GID1L3 OS=Arabidopsi... [more]
GID1_ORYSJ8.696e-1829.36Gibberellin receptor GID1 OS=Oryza sativa subsp. j... [more]
GI1L1_ARATH1.388e-1528.07Probable gibberellin receptor GID1L1 OS=Arabidopsi... [more]
GI1L2_ARATH2.368e-1527.71Probable gibberellin receptor GID1L2 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007D01EF AbioticL1 Citrus clementina cDNA clone C31007D01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868990 ID=FC868990|Name=FC868990|organism=Citrus clementina|type=EST|length=676bp
ACCAGTGATTCACCCTCCTACAGAATGGTCATCGTCAACGCCGACGGCAC
GATCACTCGCGATTACAGCAATTACCCAAGCACCACAGCCACACCCGATC
CAAATGACCACACAATTGCTGTCTCCAAAGATGTCCCCGTCAACCAATCA
AACAAGACTTGGGTCCGCATATTCCTGCCCCGTCAAGCGCTTGATTCTTC
CACCAAGACCAAGCTTCCCCTTATTGTTTATGTCCACGGCGGAGGCCTCA
TTCTCTTAAGCGCAGCCACAAAAATCTACCATGATTTATGCTCAGATATT
GCAGCCCGAGTCCCTGCTGTGATTGTGTCCGTAGATTACAGGCTTGCCCC
CGAGCACCGCCTGCCAGCGGCCTACTATGATGCCCTGGAAGTCTTGCACT
GGATCAAAACCACTCAAGAACACTGGTTAATACAGTACGCTGACTTGTAG
TCTTGTTTCATAATGGGCGATAGCGGAGGTGGCAACGTAGCTTACCACGC
AGCACTGCTAGCAGCGGCGCAAGTTGATGATTTGTTGCCTTTGAAGATCA
GAGGTCTGATATTGCTCAAGCCTTTCTTCGGTGGGGTCAAAAGGACGGAG
TCAGAGTTGAGGTTGGCGAATCAACCGATTTTACTACCATCTAGTACTGA
TTTACTGTGGCAGTTGGCATTACCGA
back to top