FC868994

Overview
NameFC868994
Unique NameFC868994
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length456
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig451 contig Ccv1_Contig451:38..493. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 1.025e-73
Identity = 138/152 (90.79%), Postives = 140/152 (92.11%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HFVQEFK KNKKDI+GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCK+INPDE           ILSGEGNEKVQDL
Sbjct:  246 HFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDL 397          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.339e-73
Identity = 138/152 (90.79%), Postives = 140/152 (92.11%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HFVQEFK KNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQLLQDFFNGKELCK+INPDE           ILSGEGNEKVQDL
Sbjct:  246 HFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDL 397          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 271.937 bits (694), Expect = 8.680e-73
Identity = 136/152 (89.47%), Postives = 140/152 (92.11%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HFVQEFK K+KKDI+GNPRALRRLRT+CERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCK+INPDE           ILSGEGNEKVQDL
Sbjct:  246 HFVQEFKRKSKKDITGNPRALRRLRTSCERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQGAILSGEGNEKVQDL 397          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 261.536 bits (667), Expect = 1.173e-69
Identity = 130/152 (85.53%), Postives = 136/152 (89.47%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HFVQEFK KNK+DI+G PRALRRLRTACERAKRTLSSTAQTTIEIDSLY G DFYS ITRARFEE+NMDLFRKCMEPVEKCLRDAKMDKSTVH++VLVGGSTRIPKVQQLLQDFFNGKELCK+INPDE           ILSGEGNEKVQDL
Sbjct:  246 HFVQEFKRKNKQDITGQPRALRRLRTACERAKRTLSSTAQTTIEIDSLYGGADFYSPITRARFEEMNMDLFRKCMEPVEKCLRDAKMDKSTVHEIVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDL 397          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 3.413e-69
Identity = 131/153 (85.62%), Postives = 138/153 (90.20%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQL-LQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HFV EFK K+KKDI+GNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQ+ + +FFNGKELCK+INPDE           ILSGEGNEKVQDL
Sbjct:  246 HFVHEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQVAMTNFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDL 398          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 5.822e-69
Identity = 129/152 (84.87%), Postives = 137/152 (90.13%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HFVQEFK KNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSL++GIDFY+ ITRARFEELN+DLFRKCMEPVEKCLRDAKMDK+++ DVVLVGGSTRIPKVQQLL DFFNGKELCK+INPDE           ILSGEGNEKVQDL
Sbjct:  246 HFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFDGIDFYAPITRARFEELNIDLFRKCMEPVEKCLRDAKMDKNSIDDVVLVGGSTRIPKVQQLLVDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDL 397          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 7.604e-69
Identity = 129/152 (84.87%), Postives = 136/152 (89.47%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HFV EFK KNKKDISGN RALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY+TITRARFEE+NMDLFRKCMEPVEKCLRDAK+DKS VH+VVLVGGSTRIPKV QLLQDFFNGKELCK+INPDE           ILSG+G+EKVQDL
Sbjct:  245 HFVSEFKRKNKKDISGNARALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYATITRARFEEMNMDLFRKCMEPVEKCLRDAKIDKSQVHEVVLVGGSTRIPKVHQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGQGDEKVQDL 396          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 254.603 bits (649), Expect = 1.434e-67
Identity = 128/152 (84.21%), Postives = 133/152 (87.50%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            H +QEFK KNKKDI   P  +RRLRTACERAKRTLSSTAQTTIEIDSLYEG+DFYS ITRARFEELN+DLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCK+INPDE           ILSGEGNEKVQDL
Sbjct:  246 HSLQEFKRKNKKDIMETPGHIRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYSPITRARFEELNIDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDL 397          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 246.899 bits (629), Expect = 2.990e-65
Identity = 126/148 (85.14%), Postives = 131/148 (88.51%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEK 444
            HFVQEFK KNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSL+EGIDF    +RARFEELNMDLFRKCMEPVEKCLRDAKMDKS+VHDVVLVGGSTRIPKVQQ LQDFFNGKELCK+INPDE           ILSGEGNE+
Sbjct:  244 HFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLFEGIDFTPRSSRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQ-LQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNER 390          
BLAST of FC868994 vs. ExPASy Swiss-Prot
Match: HSP70_CHLRE (Heat shock 70 kDa protein OS=Chlamydomonas reinhardtii GN=HSP70 PE=2 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 3.421e-61
Identity = 117/152 (76.97%), Postives = 128/152 (84.21%), Query Frame = 1
Query:    1 HFVQEFKSKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFYSTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKNINPDEXXXXXXXXXXXILSGEGNEKVQDL 456
            HF  EF+ K KKD+  +PRALRRLRTACERAKRTLSS AQTTIE+DSL+EG+DF ++ITRARFEEL MDLFRKCM+PVEKCL DAKMDK TVHDVVLVGGSTRIPKVQQLLQDFFNGKEL K+INPDE           IL+GEG EKVQDL
Sbjct:  246 HFANEFQRKYKKDLKTSPRALRRLRTACERAKRTLSSAAQTTIELDSLFEGVDFATSITRARFEELCMDLFRKCMDPVEKCLHDAKMDKMTVHDVVLVGGSTRIPKVQQLLQDFFNGKELNKSINPDEAVAYGAAVQAAILTGEGGEKVQDL 397          
The following BLAST results are available for this feature:
BLAST of FC868994 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_SOLLC1.025e-7390.79Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP7C_PETHY1.339e-7390.79Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP71_ARATH8.680e-7389.47Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP72_ARATH1.173e-6985.53Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP71_SOLLC3.413e-6985.62Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP73_ARATH5.822e-6984.87Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP70_SOYBN7.604e-6984.87Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP7E_SPIOL1.434e-6784.21Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP70_MAIZE2.990e-6585.14Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP70_CHLRE3.421e-6176.97Heat shock 70 kDa protein OS=Chlamydomonas reinhar... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007D05EF AbioticL1 Citrus clementina cDNA clone C31007D05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868994 ID=FC868994|Name=FC868994|organism=Citrus clementina|type=EST|length=456bp
CATTTTGTTCAGGAGTTTAAGTCGAAGAACAAGAAGGATATTAGTGGCAA
CCCTAGAGCTCTTAGGAGATTGAGGACTGCTTGTGAGAGAGCGAAGAGGA
CTCTCTCCTCTACTGCCCAGACTACAATTGAGATTGATTCTTTGTATGAG
GGTATTGACTTCTACTCAACCATAACTCGTGCCAGATTTGAGGAGTTGAA
CATGGATCTCTTCAGGAAGTGTATGGAGCCTGTTGAGAAATGTTTGAGGG
ATGCTAAGATGGACAAGAGCACTGTCCACGATGTTGTGCTTGTGGGTGGT
TCCACTAGGATTCCCAAGGTGCAACAGCTTTTGCAAGACTTCTTCAATGG
CAAGGAGCTCTGCAAGAACATTAATCCAGATGAGGCTGTTGCTTATGGTG
CTGCTGTTCAGGCTGCCATCCTGAGCGGCGAGGGCAATGAGAAGGTTCAG
GATCTG
back to top