FC868999

Overview
NameFC868999
Unique NameFC868999
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length701
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9440 contig Ccv1_Contig9440:1..701. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL17_ARATH (Beta-glucosidase 17 OS=Arabidopsis thaliana GN=BGLU17 PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.467e-63
Identity = 109/153 (71.24%), Postives = 131/153 (85.62%), Query Frame = 3
Query:  243 RNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            R+SFP +F FG ASSAYQ EGAA+V GR+PS+WDTF    PEKI D SNGDVAD FY+R+KED+A +K++G DS RFSISWSRILP G ++GGVNQ G++FYN+LINELIS G++P VTLFHWDTPQALEDEYGGFL+P+IVKDF +Y D+CF
Sbjct:   37 RSSFPQDFRFGAASSAYQSEGAANVDGREPSIWDTFTKQYPEKISDGSNGDVADEFYYRFKEDVAHMKEIGLDSFRFSISWSRILPRGTVAGGVNQAGINFYNHLINELISNGIRPLVTLFHWDTPQALEDEYGGFLNPQIVKDFVEYVDICF 189          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL15_ARATH (Beta-glucosidase 15 OS=Arabidopsis thaliana GN=BGLU15 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.589e-60
Identity = 103/153 (67.32%), Postives = 124/153 (81.05%), Query Frame = 3
Query:  243 RNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            R+ FP +F+FG+A+SAYQ EG AH  GR PS+WDTF+   PEKI D SNG VADN Y  YKED+AL+ Q+GF++ RFSISWSRILP GN+ GG+NQ G+D+YNNLINEL+S G+KPF T+FHWDTPQALED YGGF   +IV DF DYAD+CF
Sbjct:   33 RSDFPEDFIFGSATSAYQVEGGAHEDGRGPSIWDTFSEKYPEKIKDGSNGSVADNSYHLYKEDVALLHQIGFNAYRFSISWSRILPRGNLKGGINQAGIDYYNNLINELLSKGIKPFATMFHWDTPQALEDAYGGFRGAEIVNDFRDYADICF 185          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL12_ORYSJ (Beta-glucosidase 12 OS=Oryza sativa subsp. japonica GN=BGLU12 PE=2 SV=2)

HSP 1 Score: 228.024 bits (580), Expect = 3.739e-59
Identity = 100/154 (64.94%), Postives = 126/154 (81.82%), Query Frame = 3
Query:  240 TRNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            +R SFP  F+FGTASS+YQYEG A  GGR PS+WDTF    PEKI D SNGDVA + Y  YKED+ L+K +G D+ RFSISW+RILP+G++ GGVN++G+ +YNNLINEL+S G++PF+TLFHWD+PQALED+Y GFLSP I+ DF DYA++CF
Sbjct:   35 SRRSFPKGFIFGTASSSYQYEGGAAEGGRGPSIWDTFTHQHPEKIADRSNGDVASDSYHLYKEDVRLMKDMGMDAYRFSISWTRILPNGSLRGGVNKEGIKYYNNLINELLSKGVQPFITLFHWDSPQALEDKYNGFLSPNIINDFKDYAEICF 188          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL12_ARATH (Beta-glucosidase 12 OS=Arabidopsis thaliana GN=BGLU12 PE=2 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.378e-59
Identity = 104/171 (60.82%), Postives = 129/171 (75.44%), Query Frame = 3
Query:  201 ICLSSVCLPCYGST----RNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            + L+ V    + ST    R+ FP +F+FG A+SAYQ EGAAH  GR PS+WDTF+   PEKI D SNG +A + Y  YKED+ L+ Q+GFD+ RFSISWSRILP  N+ GG+NQ G+D+YNNLINEL+S G+KPF T+FHWDTPQ+LED YGGFL  +IV DF DYAD+CF
Sbjct:   15 LALNEVMAKKHSSTPKLRRSDFPEDFIFGAATSAYQVEGAAHEDGRGPSIWDTFSEKYPEKIKDGSNGSIASDSYHLYKEDVGLLHQIGFDAYRFSISWSRILPRENLKGGINQAGIDYYNNLINELLSKGIKPFATIFHWDTPQSLEDAYGGFLGAEIVNDFRDYADICF 185          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL13_ARATH (Beta-glucosidase 13 OS=Arabidopsis thaliana GN=BGLU13 PE=2 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 2.424e-58
Identity = 105/188 (55.85%), Postives = 136/188 (72.34%), Query Frame = 3
Query:  150 VEVKFQNLFVCYLITSSICLSSVCLPCYGST----RNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            +  K+ +L V  ++ +S   + V    + ST    R+ FP +F+FG A+SAYQ EGAAH  GR PS+WDTF+   PEKI D +NG +A + Y  YKED+ L+ Q+GF + RFSISWSRILP GN+ GG+NQ G+D+YNNLINEL+S G+KPF T+FHWDTPQ+LED YGGF   +IV DF DYAD+CF
Sbjct:    1 MRTKYFSLLVFIIVLAS---NEVIAKKHSSTPKLRRSDFPKDFIFGAATSAYQVEGAAHEDGRGPSIWDTFSEKYPEKIKDGTNGSIASDSYHLYKEDVGLLHQIGFGAYRFSISWSRILPRGNLKGGINQAGIDYYNNLINELLSKGIKPFATIFHWDTPQSLEDAYGGFFGAEIVNDFRDYADICF 185          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL14_ARATH (Beta-glucosidase 14 OS=Arabidopsis thaliana GN=BGLU14 PE=2 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 2.052e-57
Identity = 98/153 (64.05%), Postives = 120/153 (78.43%), Query Frame = 3
Query:  243 RNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            +  FP +F+FG A+SAYQ EGAA   GR PS+WDTF+   PEKI D SNG +AD+ Y  YKED+ L+ Q+GF++ RFSISWSRILP GN+ GG+NQ G+D+YNNLINEL+S G+KPF T+FHWDTPQ LED YGGF   +IV DF DYAD+CF
Sbjct:   32 KTDFPEDFIFGAATSAYQVEGAAQEDGRGPSIWDTFSEKYPEKIKDGSNGSIADDSYHLYKEDVGLLHQIGFNAYRFSISWSRILPRGNLKGGINQAGIDYYNNLINELLSKGIKPFATIFHWDTPQDLEDAYGGFRGAEIVNDFRDYADICF 184          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL24_ORYSJ (Beta-glucosidase 24 OS=Oryza sativa subsp. japonica GN=BGLU24 PE=2 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 2.680e-57
Identity = 99/153 (64.71%), Postives = 125/153 (81.70%), Query Frame = 3
Query:  243 RNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            R+ FP +F FGTASSAYQYEGA   GGR PS+WDTF  + PEKI + SNGD+A + Y RYKED+ ++K +G ++ RFS+SW RILP+G +SGGVN +G+ +YNNLI+ELIS G++PFVTLFHWD+PQALE +YGGFLS  IV+DF DYAD+CF
Sbjct:   30 RSQFPEDFFFGTASSAYQYEGAVREGGRGPSIWDTFTHNHPEKIANGSNGDIAIDSYHRYKEDVGIMKGLGLNAYRFSVSWPRILPNGKLSGGVNLEGIKYYNNLIDELISKGVEPFVTLFHWDSPQALEQQYGGFLSNLIVEDFRDYADICF 182          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL13_ORYSJ (Beta-glucosidase 13 OS=Oryza sativa subsp. japonica GN=BGLU13 PE=2 SV=2)

HSP 1 Score: 221.476 bits (563), Expect = 3.500e-57
Identity = 96/154 (62.34%), Postives = 125/154 (81.17%), Query Frame = 3
Query:  240 TRNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            +R SFP  F+FGTASS+YQYEG A  GGR PS+WDTF    P+KI D SNGDVA + Y  YKED+ ++K +G D+ RFSISW+RILP+G++SGG+N++G+ +YNNLINEL+  G++PFVTLFHWD+PQALED+Y GFLSP I+ D+ +YA+ CF
Sbjct:   31 SRRSFPEGFIFGTASSSYQYEGGAREGGRGPSIWDTFTHQHPDKIADKSNGDVAADSYHLYKEDVRIMKDMGVDAYRFSISWTRILPNGSLSGGINREGISYYNNLINELLLKGVQPFVTLFHWDSPQALEDKYNGFLSPNIINDYKEYAETCF 184          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL09_ORYSJ (Putative beta-glucosidase 9 OS=Oryza sativa subsp. japonica GN=BGLU9 PE=5 SV=2)

HSP 1 Score: 220.705 bits (561), Expect = 5.969e-57
Identity = 101/177 (57.06%), Postives = 137/177 (77.40%), Query Frame = 3
Query:  171 LFVCYLITSSICLSSVCLPCYGSTRNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            L +  L+ ++ C+ +  LP    +R SFP  F+FGT+S++YQ EG A  GGR PS+WDTF    P+KI D SNGDVADN Y  YKED+ ++K++G D+ RFSISWSRILP+G+++GGVN +G+++YNNLINEL+  G++ FVTLFH+DTPQALED+Y GFLSP I+ D+ DYA++CF
Sbjct:   17 LLLLLLLLAAACVEAGELPPI--SRRSFPKGFIFGTSSASYQCEGGAAEGGRGPSIWDTFTYQHPDKIADKSNGDVADNTYHLYKEDVHMMKEMGMDAYRFSISWSRILPNGSLNGGVNIEGINYYNNLINELLLKGVQSFVTLFHYDTPQALEDKYNGFLSPNIINDYKDYAEICF 191          
BLAST of FC868999 vs. ExPASy Swiss-Prot
Match: BGL16_ARATH (Beta-glucosidase 16 OS=Arabidopsis thaliana GN=BGLU16 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.330e-56
Identity = 98/153 (64.05%), Postives = 122/153 (79.74%), Query Frame = 3
Query:  243 RNSFPPEFLFGTASSAYQYEGAAHVGGRKPSVWDTFAMDQPEKILDHSNGDVADNFYFRYKEDIALVKQVGFDSLRFSISWSRILPHGNISGGVNQQGVDFYNNLINELISYGLKPFVTLFHWDTPQALEDEYGGFLSPKIVKDFGDYADLCF 701
            RN FP +F+FG+A+SAYQ EGAAH  GR PS+WD+F+   PEKI+D SNG +AD+ Y  YKED+ L+ Q+GFD+ RFSISWSRILP G + GG+NQ G+++YNNLIN+LIS G+KPFVTLFHWD P ALE+ YGG L  + V DF DYA+LCF
Sbjct:   32 RNDFPQDFVFGSATSAYQCEGAAHEDGRGPSIWDSFSEKFPEKIMDGSNGSIADDSYNLYKEDVNLLHQIGFDAYRFSISWSRILPRGTLKGGINQAGIEYYNNLINQLISKGVKPFVTLFHWDLPDALENAYGGLLGDEFVNDFRDYAELCF 184          
The following BLAST results are available for this feature:
BLAST of FC868999 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 172
Match NameE-valueIdentityDescription
BGL17_ARATH1.467e-6371.24Beta-glucosidase 17 OS=Arabidopsis thaliana GN=BGL... [more]
BGL15_ARATH2.589e-6067.32Beta-glucosidase 15 OS=Arabidopsis thaliana GN=BGL... [more]
BGL12_ORYSJ3.739e-5964.94Beta-glucosidase 12 OS=Oryza sativa subsp. japonic... [more]
BGL12_ARATH6.378e-5960.82Beta-glucosidase 12 OS=Arabidopsis thaliana GN=BGL... [more]
BGL13_ARATH2.424e-5855.85Beta-glucosidase 13 OS=Arabidopsis thaliana GN=BGL... [more]
BGL14_ARATH2.052e-5764.05Beta-glucosidase 14 OS=Arabidopsis thaliana GN=BGL... [more]
BGL24_ORYSJ2.680e-5764.71Beta-glucosidase 24 OS=Oryza sativa subsp. japonic... [more]
BGL13_ORYSJ3.500e-5762.34Beta-glucosidase 13 OS=Oryza sativa subsp. japonic... [more]
BGL09_ORYSJ5.969e-5757.06Putative beta-glucosidase 9 OS=Oryza sativa subsp.... [more]
BGL16_ARATH1.330e-5664.05Beta-glucosidase 16 OS=Arabidopsis thaliana GN=BGL... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007D10EF AbioticL1 Citrus clementina cDNA clone C31007D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC868999 ID=FC868999|Name=FC868999|organism=Citrus clementina|type=EST|length=701bp
GGAAATTGAATAAAATAATAGCTCACTGTACGTACTGCTTAATTAATATA
TGTATTTGGGGGCGGGTTAGGTTATGCATCATATACTACTATTAGTTCAT
AATGATGAAGCTTCCATATATAATTCATCGGAAGGGAGAGGTAGGGAGAG
TGGAAGTTAAATTTCAGAATCTTTTTGTCTGTTATCTGATCACATCTTCG
ATTTGCTTATCATCTGTATGCCTCCCCTGCTACGGCTCCACTCGGAATAG
CTTTCCGCCTGAGTTTTTATTTGGAACAGCATCAAGTGCTTACCAGTATG
AAGGAGCAGCTCACGTTGGAGGGAGGAAACCAAGCGTATGGGATACCTTC
GCCATGGATCAACCAGAGAAAATTTTGGACCACAGTAATGGGGATGTAGC
TGACAACTTTTACTTTCGTTACAAGGAGGACATTGCTTTGGTGAAGCAAG
TTGGTTTCGACTCCCTAAGATTCTCAATATCATGGTCCAGAATTTTACCT
CATGGAAATATTAGTGGGGGAGTGAACCAACAAGGTGTCGATTTCTACAA
TAATCTCATCAACGAGCTCATTTCATACGGCTTAAAGCCCTTTGTGACTT
TATTCCACTGGGACACTCCACAAGCTCTAGAAGATGAATATGGTGGATTC
TTAAGTCCTAAAATTGTAAAAGATTTTGGTGACTATGCGGACTTGTGCTT
C
back to top