FC869009

Overview
NameFC869009
Unique NameFC869009
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length676
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9479 contig Ccv1_Contig9479:2..677. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869009 vs. ExPASy Swiss-Prot
Match: BURP3_ORYSJ (BURP domain-containing protein 3 OS=Oryza sativa subsp. japonica GN=BURP3 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.338e-26
Identity = 57/85 (67.06%), Postives = 66/85 (77.65%), Query Frame = 1
Query:  421 PVYVGVSPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVE 675
            PV+V V+PF Y YAA E QLHDDPN ALFFLEKDLHPG  M +HFT T+ G  FL R  A + PFSS+K+PEI ++FSVKPGSVE
Sbjct:  185 PVHVNVAPFIYNYAATETQLHDDPNVALFFLEKDLHPGKTMAVHFTATTAGEKFLPRSEADAMPFSSEKVPEILSRFSVKPGSVE 269          
BLAST of FC869009 vs. ExPASy Swiss-Prot
Match: RD22_ARATH (Dehydration-responsive protein RD22 OS=Arabidopsis thaliana GN=RD22 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 5.086e-26
Identity = 82/219 (37.44%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  121 VASHAAISPELYWKTVLPNSPMPKAVKDLLQPDVLEDKSTSVNVGKGGVN----------------------VDAGKXXXXXXXXXXXXXXXXXXXXXXXD-----KRXXXXXXXXXXXXXXXXXXXPVYVGV----SPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTS--NGAT-FLSRQAAKSTPFSSDKLPEIFNQFSVKPGSVE 675
            VA  A ++PE YW T LPN+P+P ++ +LL  D  ++KST+V VGKGGVN                      VD GK                             KR                   P+YVGV    +PF Y YAA E QLHDDPN ALFFLEKDL  G +MN+ F       G T FL R  A++ PF S+K  E   +FSV+ GS E
Sbjct:   17 VAIAADLTPERYWSTALPNTPIPNSLHNLLTFDFTDEKSTNVQVGKGGVNVNTHKGKTGSGTAVNVGKGGVRVDTGKGKPGGGTHVSVGSGKGHGGGVAVHTGKPGKRTDVGVGKGGVTVHTRHKGRPIYVGVKPGANPFVYNYAAKETQLHDDPNAALFFLEKDLVRGKEMNVRFNAEDGYGGKTAFLPRGEAETVPFGSEKFSETLKRFSVEAGSEE 235          
BLAST of FC869009 vs. ExPASy Swiss-Prot
Match: BURP2_ORYSJ (BURP domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=BURP2 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.876e-12
Identity = 36/70 (51.43%), Postives = 48/70 (68.57%), Query Frame = 1
Query:  460 AANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGS 669
            AA+ ++  +D   ++FFLEKDL PG KM LHFT+ + GA  L R  A S PF+S+KLPEI +Q S+  GS
Sbjct:   52 AASASKDKEDTVGSVFFLEKDLFPGSKMTLHFTRATAGAALLPRGRADSVPFASEKLPEILSQLSIPAGS 121          
BLAST of FC869009 vs. ExPASy Swiss-Prot
Match: BURP6_ORYSJ (BURP domain-containing protein 6 OS=Oryza sativa subsp. japonica GN=BURP6 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.130e-12
Identity = 35/62 (56.45%), Postives = 42/62 (67.74%), Query Frame = 1
Query:  484 DDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSVKPGS 669
            +D    +FFLEKDL PG KM LHFT+ + GA  L R  A S PF+S+KLPEI +Q SV  GS
Sbjct:   21 EDTVNNVFFLEKDLFPGSKMTLHFTRATAGAALLPRGRADSVPFASEKLPEILSQLSVPAGS 82          
BLAST of FC869009 vs. ExPASy Swiss-Prot
Match: BURP1_ORYSJ (BURP domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=BURP1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.036e-11
Identity = 35/74 (47.30%), Postives = 50/74 (67.57%), Query Frame = 1
Query:  436 VSPFNYVYAANENQLHDDPNTALFFLEKDLHPGMKMNLHFTQTSNGATFLSRQAAKSTPFSSDKLPEIFNQFSV 657
            +SP + V +A++    +D    +FFLEKDL PG KM LHFT+ + GA  L R  A+S PF+S++LPEI +Q S+
Sbjct:   46 ISPASSVGSASK----EDTVGNVFFLEKDLFPGSKMTLHFTRATAGAALLPRGRAESVPFASERLPEILSQLSI 115          
The following BLAST results are available for this feature:
BLAST of FC869009 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
BURP3_ORYSJ1.338e-2667.06BURP domain-containing protein 3 OS=Oryza sativa s... [more]
RD22_ARATH5.086e-2637.44Dehydration-responsive protein RD22 OS=Arabidopsis... [more]
BURP2_ORYSJ1.876e-1251.43BURP domain-containing protein 2 OS=Oryza sativa s... [more]
BURP6_ORYSJ7.130e-1256.45BURP domain-containing protein 6 OS=Oryza sativa s... [more]
BURP1_ORYSJ6.036e-1147.30BURP domain-containing protein 1 OS=Oryza sativa s... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007E08EF AbioticL1 Citrus clementina cDNA clone C31007E08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869009 ID=FC869009|Name=FC869009|organism=Citrus clementina|type=EST|length=676bp
GATGAAAGCCTAGATTTTAGATCCATACTATCTTGTATTCTGAGTGTCTT
TTGAAACATACTCAAAGCTATAATGGAGTTTCGCTTGTTGCCCATCCTTG
CTTTCCTCAGTCTAGCACTGGTGGCAAGTCATGCTGCCATTTCTCCTGAG
CTTTACTGGAAAACTGTATTGCCAAATTCCCCGATGCCAAAAGCTGTCAA
AGATCTTCTACAGCCAGATGTGCTGGAAGACAAAAGCACCTCTGTCAACG
TAGGGAAGGGTGGTGTCAATGTGGATGCAGGGAAAGGAAAGCCCGGTGGT
GGCACCCATGTGAATGTTGGGGGTAAGGGCGTTGGTGTAAACACTGGAAA
GCCTGACAAAAGAACCAGTGTTGGTGTTGGCAAAGGAGGAGTATCCGTAA
GTACAGGACACAAGGGAAAGCCAGTTTATGTTGGAGTAAGCCCATTCAAC
TATGTATATGCTGCAAATGAGAACCAACTCCATGATGACCCGAATACAGC
TCTTTTCTTCTTGGAAAAGGACTTGCATCCTGGGATGAAGATGAACTTGC
ACTTCACTCAAACTTCAAATGGAGCAACTTTCTTATCTCGCCAAGCTGCC
AAATCAACTCCTTTCTCGTCTGACAAATTGCCTGAGATCTTTAACCAGTT
TTCCGTGAAACCTGGATCAGTTGAAG
back to top