FC869012

Overview
NameFC869012
Unique NameFC869012
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9445 contig Ccv1_Contig9445:1..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_MANES (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Manihot esculenta GN=WAXY PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.878e-48
Identity = 105/199 (52.76%), Postives = 127/199 (63.82%), Query Frame = 1
Query:  106 MATAVAASSFVSRSYGHEVASGLNSKASQMKF-----RCMKHSGLRSLNIIDELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            MAT +AA  FVSRS  H     L +KA+ +       + +  +GLRSLN +D+LQ+KT  SK      A  NG      P+  I+CG G+N++FVG EV PWSKT                  HRVMT++PRYDQYKDAWDT V +E+K+GD+IE VRFFH +KRGVDRVFVDHP FL KVWGKT S IYGPR G DYQ
Sbjct:    1 MATVIAAH-FVSRS-SHLSIHALETKANNLSHTGPWTQTITPNGLRSLNTMDKLQMKTQ-SKAVKKVSATGNG-----RPAAKIICGHGMNLIFVGAEVGPWSKTGGLGDVLGGLPPAMAARGHRVMTVSPRYDQYKDAWDTSVSVEIKIGDRIETVRFFHSYKRGVDRVFVDHPMFLEKVWGKTGSKIYGPRAGLDYQ 191          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_SOLTU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum GN=WAXY PE=1 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 6.615e-48
Identity = 103/195 (52.82%), Postives = 125/195 (64.10%), Query Frame = 1
Query:  106 MATAVAASSFVSRSYGHEVASGLNSKASQMKFR--CMKHSGLRSLNIIDELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDY 684
            MA+  A+  FVSRS   + +    S  SQ+  R   + H+GLR++N +D LQ +T      T + A R   + + G S  IVCG G+N++FVGTEV PWSKT                  HRVMTI+PRYDQYKDAWDT V +E+KVGD IE VRFFHC+KRGVDRVFVDHP FL KVWGKT S IYGP+ G DY
Sbjct:    1 MASITASHHFVSRS---QTSLDTKSTLSQIGLRNHTLTHNGLRAVNKLDGLQSRTNTK--VTPKMASRTETK-RPGCSATIVCGKGMNLIFVGTEVGPWSKTGGLGDVLGGLPPALAARGHRVMTISPRYDQYKDAWDTSVAVEVKVGDSIEIVRFFHCYKRGVDRVFVDHPMFLEKVWGKTGSKIYGPKAGLDY 189          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_ANTMA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Antirrhinum majus GN=WAXY PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 3.283e-47
Identity = 100/197 (50.76%), Postives = 126/197 (63.96%), Query Frame = 1
Query:  106 MATAVAASSFVSRSYGHEVAS-GLNSKASQMKFRCMK--HSGLRSLNIIDELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            MAT V AS  VS  +G   +S    +  +Q+  R  +  H+GLRS+N++D+LQ++  A +  +  +   NG      P   I+CG G+N++FV  EV PWSKT                  HRVMT++PRYDQYKDAWDT VV+E+KVGD IE VRFFHC+KRGVDRVFVDHP FL KVWGKT+S IYGP  G DYQ
Sbjct:    1 MAT-VTASQLVSHVHGGATSSPDTKTNLAQVGLRNQQFTHNGLRSINMVDKLQMRNNAKQSRSLVKKTDNG-----SPLGKIICGTGMNLVFVLAEVGPWSKTGGLGDVVGGLPPAMAGNGHRVMTVSPRYDQYKDAWDTSVVVEIKVGDSIETVRFFHCYKRGVDRVFVDHPIFLEKVWGKTKSKIYGPNAGTDYQ 191          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_ARATH (Probable granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=WAXY PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.779e-46
Identity = 100/196 (51.02%), Postives = 128/196 (65.31%), Query Frame = 1
Query:  106 MATAVAASSFVSRS--YGHEVASGLNSKAS-QMKFRCMKHSGLRSLNIIDELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDY 684
            MAT  A+S+FVSR+  + +  AS  +  A   +K + + H GLRS N++D LQ ++ A K  +++ + R+      G    IVC  G++++F+G EV PWSKT                  HRVMTI PRYDQYKDAWDT VV+++KVGDK+E VRFFHC+KRGVDRVFVDHP FLAKV GKT S IYGP TG DY
Sbjct:    1 MATVTASSNFVSRTSLFNNHGASSCSDVAQITLKGQSLTHCGLRSFNMVDNLQRRSQA-KPVSAKSSKRSSKVKTAGK---IVCEKGMSVIFIGAEVGPWSKTGGLGDVLGGLPPALAARGHRVMTICPRYDQYKDAWDTCVVVQIKVGDKVENVRFFHCYKRGVDRVFVDHPIFLAKVVGKTGSKIYGPITGVDY 192          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_IPOBA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Ipomoea batatas GN=WAXY PE=2 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 9.885e-44
Identity = 98/198 (49.49%), Postives = 122/198 (61.62%), Query Frame = 1
Query:  106 MATAVAASSFVSRSYGHEVASGLNSKASQMKFR--CMKHSGLRSLNIIDELQVKTMASKLATSRQAGRNGFRSQNGPSL-MIVCGV-GLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            MAT + AS FVS   G   +        Q+  R   + H+GLR +N ID LQ++T A K        +NG  ++ G +   IVC   G+N++FVG EV PW KT                  HRVMT+ PRYDQYKDAWDT VV+EL+VGD+IE VRFFH +KRGVDRVFVDHP FL KVWGKT S +YGP+ G+DY+
Sbjct:    1 MAT-ITASHFVSHVCGGATSGESKVGLGQLALRSQAVTHNGLRPVNKIDMLQLRTSAKK------PSKNGRENEGGMAAGTIVCKQQGMNLVFVGCEVGPWCKTGGLGDVLGGLPPALAARGHRVMTVCPRYDQYKDAWDTCVVVELQVGDRIEPVRFFHSYKRGVDRVFVDHPMFLEKVWGKTGSMLYGPKAGKDYK 191          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_SORBI (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Sorghum bicolor GN=WAXY PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.336e-40
Identity = 77/148 (52.03%), Postives = 95/148 (64.19%), Query Frame = 1
Query:  244 DELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            D L ++T A      + A R G R    PSL++    G+N++FVG E+APWSKT                  HRVM ++PRYDQYKDAWDT VV E+K+GD  E VRFFHC+KRGVDRVF+DHP FL +VWGKT+  IYGP  G DY+
Sbjct:   44 DALSMRTSACPAPRQQPAARRGGRGGRFPSLVVCATAGMNVVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVMVVSPRYDQYKDAWDTSVVSEIKMGDGYETVRFFHCYKRGVDRVFIDHPLFLERVWGKTEEKIYGPDAGTDYK 191          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_MAIZE (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Zea mays GN=WAXY PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.887e-40
Identity = 80/156 (51.28%), Postives = 98/156 (62.82%), Query Frame = 1
Query:  220 GLRSLNIIDELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            G R+    D L ++T A      +Q  R G R    PSL++    G+N++FVG E+APWSKT                  HRVM ++PRYDQYKDAWDT VV E+K+GD  E VRFFHC+KRGVDRVFVDHP FL +VWGKT+  IYGP  G DY+
Sbjct:   34 GARASAAADTLSMRTSARAAPRHQQQARRGGRF---PSLVVCASAGMNVVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVMVVSPRYDQYKDAWDTSVVSEIKMGDGYETVRFFHCYKRGVDRVFVDHPLFLERVWGKTEEKIYGPVAGTDYR 186          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_PEA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.520e-39
Identity = 84/156 (53.85%), Postives = 105/156 (67.31%), Query Frame = 1
Query:  220 GLRSLNIIDELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            GLRSLN   +L V+T  +   +S  + ++  +        IVCG+ L  +FVG EV PWSKT                  HRVMT++PRYDQYKDAWDT+V++E+KVGDKIE VRFFHC+KRGVDRVFVDHP FL +VWGKT S +YGP+TG DY+
Sbjct:   44 GLRSLN---KLHVRTARATSGSSDTSEKSLGK--------IVCGMSL--VFVGAEVGPWSKTGGLGDVLGGLPPVLAGNGHRVMTVSPRYDQYKDAWDTNVLVEVKVGDKIETVRFFHCYKRGVDRVFVDHPLFLERVWGKTGSKLYGPKTGIDYR 186          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1B_HORVU (Granule-bound starch synthase 1b, chloroplastic/amyloplastic (Fragment) OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.575e-39
Identity = 78/141 (55.32%), Postives = 94/141 (66.67%), Query Frame = 1
Query:  265 MASKLATSRQAGRNGFRSQNGPSLMIVCGVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            +A + AT+ +  RN  R+    S  IVC  G+ I+FV TEV PW KT                  HRVMTIAPRYDQYKD WDT+V++E+ VGD+ E VRFFHC+KRGVDRVFVDHP FL KVWGKT S +YGP TG D++
Sbjct:   11 LAKRRATNYETHRNSSRT----SSPIVCSTGMPIIFVATEVHPWCKTGGLGDVVGGLPPALAAMGHRVMTIAPRYDQYKDTWDTNVLVEVIVGDRTETVRFFHCYKRGVDRVFVDHPMFLEKVWGKTGSKLYGPTTGTDFR 147          
BLAST of FC869012 vs. ExPASy Swiss-Prot
Match: SSG1_ORYSJ (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=WAXY PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.633e-38
Identity = 78/149 (52.35%), Postives = 95/149 (63.76%), Query Frame = 1
Query:  244 DELQVKTMASKLATSRQAGRNGFRSQNGPSLMIVC-GVGLNILFVGTEVAPWSKTXXXXXXXXXXXXXXXXXXHRVMTIAPRYDQYKDAWDTDVVIELKVGDKIEKVRFFHCHKRGVDRVFVDHPWFLAKVWGKTQSXIYGPRTGEDYQ 687
            D   +    S  AT +Q       S+  PS+++   G G+N++FVG E+APWSKT                  HRVM I+PRYDQYKDAWDT VV E+KV D+ E+VRFFHC+KRGVDRVF+DHP FL KVWGKT   IYGP TG DY+
Sbjct:   44 DATSLSVTTSARATPKQQRSVQRGSRRFPSVVVYATGAGMNVVFVGAEMAPWSKTGGLGDVLGGLPPAMAANGHRVMVISPRYDQYKDAWDTSVVAEIKVADRYERVRFFHCYKRGVDRVFIDHPSFLEKVWGKTGEKIYGPDTGVDYK 192          
The following BLAST results are available for this feature:
BLAST of FC869012 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
SSG1_MANES3.878e-4852.76Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_SOLTU6.615e-4852.82Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ANTMA3.283e-4750.76Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_ARATH2.779e-4651.02Probable granule-bound starch synthase 1, chloropl... [more]
SSG1_IPOBA9.885e-4449.49Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_SORBI1.336e-4052.03Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_MAIZE3.887e-4051.28Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1_PEA2.520e-3953.85Granule-bound starch synthase 1, chloroplastic/amy... [more]
SSG1B_HORVU9.575e-3955.32Granule-bound starch synthase 1b, chloroplastic/am... [more]
SSG1_ORYSJ1.633e-3852.35Granule-bound starch synthase 1, chloroplastic/amy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007E12EF AbioticL1 Citrus clementina cDNA clone C31007E12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869012 ID=FC869012|Name=FC869012|organism=Citrus clementina|type=EST|length=700bp
GGTTCGCTTCACGTTCATTCATCGACGCTTGAGCACCAGATTTCATCAGG
AAACTAAGAGGGAAACAAATCTTCAGCAGAGACTACAAACATAATAATAT
CAGCTATGGCTACCGCTGTAGCCGCTTCAAGCTTCGTCTCAAGGAGTTAT
GGACATGAGGTAGCTTCAGGATTGAATAGTAAGGCATCACAGATGAAATT
TAGGTGTATGAAGCACAGTGGGCTGAGAAGTTTAAATATCATAGACGAAC
TCCAAGTGAAAACAATGGCATCAAAACTAGCCACCAGCAGGCAAGCTGGG
AGGAATGGATTTAGAAGCCAGAACGGGCCATCCTTAATGATTGTTTGTGG
GGTTGGCCTGAATATCCTCTTTGTTGGAACAGAGGTTGCTCCTTGGAGTA
AAACTGGGGGACTTGGTGATGTTCTTGGAGGTCTGCCACCAGCACTGGCC
GCCAATGGGCACCGTGTCATGACGATTGCACCCCGATATGACCAGTACAA
AGATGCTTGGGATACTGATGTTGTAATTGAGCTGAAAGTTGGAGACAAAA
TTGAAAAAGTTCGCTTCTTTCATTGCCACAAGAGAGGAGTTGATCGGGTG
TTTGTGGATCATCCTTGGTTTCTTGCGAAGGTGTGGGGTAAAACCCAATC
CNAAATCTATGGGCCTAGGACTGGAGAGGACTACCAGACAACCAACTCGC
back to top