FC869014

Overview
NameFC869014
Unique NameFC869014
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length664
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR1_ARATH (Vacuolar-sorting receptor 1 OS=Arabidopsis thaliana GN=VSR1 PE=1 SV=2)

HSP 1 Score: 342.428 bits (877), Expect = 1.224e-93
Identity = 157/208 (75.48%), Postives = 184/208 (88.46%), Query Frame = 2
Query:   41 KLGFLVGILFLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            KLG       L+  L+ GRFVVEKN+LKVTSP+ IKG+YECAIGNFGVPQYGGTL+GTVVYPK+NQKACK + + D+SFKS+PG LPTF+L+DRGDCYFTLKAW AQ+ GAAAILVAD K EPLITMDTPEE+ +DA+YLQNITIPSALI+K+LGDSIK +LSGG+MVNM LDWTE++PHPDERVEYE WTNSNDECG KC++QI+F+
Sbjct:    2 KLGLFTLSFLLILNLAMGRFVVEKNNLKVTSPDSIKGIYECAIGNFGVPQYGGTLVGTVVYPKSNQKACKSYSDFDISFKSKPGRLPTFVLIDRGDCYFTLKAWIAQQAGAAAILVADSKAEPLITMDTPEEDKSDADYLQNITIPSALITKTLGDSIKSALSGGDMVNMKLDWTESVPHPDERVEYELWTNSNDECGKKCDTQIEFL 209          
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR2_ARATH (Vacuolar-sorting receptor 2 OS=Arabidopsis thaliana GN=VSR2 PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.695e-82
Identity = 143/213 (67.14%), Postives = 179/213 (84.04%), Query Frame = 2
Query:   32 MREKLGFLVGILFLLCGLSF--GRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            MR    +LV I+++  G S   GRFVVEKN+L+VTSPE I+GVYECA+GNFGVPQYGG++ G VVYPK NQKACK FD+ ++SF+SR  GLPTF+LVDRGDCYFTLKAWNAQ+ GAA ILVAD++ E LITMD PE+E +DA+YLQNITIPSAL+S+SLG +IK +++ G+ V+++LDW EALPHP++RV YE WTNSNDECG KC++QI F+
Sbjct:    1 MRTTNVWLVVIVWVTVGWSSCTGRFVVEKNNLRVTSPESIRGVYECALGNFGVPQYGGSMSGAVVYPKTNQKACKNFDDFEISFRSRVAGLPTFVLVDRGDCYFTLKAWNAQRAGAATILVADNRPEQLITMDAPEDETSDADYLQNITIPSALVSRSLGSAIKTAIAHGDPVHISLDWREALPHPNDRVAYELWTNSNDECGSKCDAQIRFL 213          
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR3_ARATH (Vacuolar-sorting receptor 3 OS=Arabidopsis thaliana GN=VSR3 PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.404e-81
Identity = 137/207 (66.18%), Postives = 173/207 (83.57%), Query Frame = 2
Query:   44 LGFLVGILFLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            L +L+ +  L+  L+  RFVVEKNSL VTSPE IKG ++ AIGNFG+PQYGG++ GTVVYPK NQK+CK F +  +SFKS+PG LPTFLLVDRGDC+F LK WNAQK GA+A+LVAD+  EPLITMDTPEE+ + A+Y++NITIPSAL++K  G+ +KK++SGG+MVN+NLDW EA+PHPD+RVEYE WTNSNDECG KC+  ++FV
Sbjct:    8 LPWLLLLTLLVSPLNDARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMEFV 214          
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR4_ARATH (Vacuolar-sorting receptor 4 OS=Arabidopsis thaliana GN=VSR4 PE=2 SV=2)

HSP 1 Score: 300.056 bits (767), Expect = 6.968e-81
Identity = 139/214 (64.95%), Postives = 175/214 (81.78%), Query Frame = 2
Query:   32 MREKLGFLVGILFLLCGLS---FGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            M++ L +L  +L L   +S     RFVVEKNSL VTSPE IKG ++ AIGNFG+PQYGG++ GTVVYPK NQK+CK F +  +SFKS+PG LPTFLLVDRGDC+F LK WNAQK GA+A+LVAD+  EPLITMDTPEE+ + A+Y++NITIPSAL++K  G+ +KK++SGG+MVN+NLDW EA+PHPD+RVEYE WTNSNDECG KC+  ++FV
Sbjct:    1 MKQLLCYLPWLLLLSLVVSPFNEARFVVEKNSLSVTSPESIKGTHDSAIGNFGIPQYGGSMAGTVVYPKENQKSCKEFSDFSISFKSQPGALPTFLLVDRGDCFFALKVWNAQKAGASAVLVADNVDEPLITMDTPEEDVSSAKYIENITIPSALVTKGFGEKLKKAISGGDMVNLNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLMEFV 214          
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR1_PEA (Vacuolar-sorting receptor 1 OS=Pisum sativum GN=BP80 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.242e-79
Identity = 138/208 (66.35%), Postives = 168/208 (80.77%), Query Frame = 2
Query:   41 KLGFLVGILFLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            +L  ++ + F+L  LS  RFVVEKNSL VTSPEKIKG ++ AIGNFG+PQYGG++ G VVYPK N K CK FD    SFKSRPG LPT LL+DRG C+F LK WNAQK GA+A+LVADD  EPLITMDTPEE+ + A+Y++NITIPSALI KS G+ +K ++SGG+MVN+NLDW EA+PHPD+RVEYE WTNSNDECG KC+  I+F+
Sbjct:    5 RLSAILFLGFMLTSLSTARFVVEKNSLSVTSPEKIKGKHDSAIGNFGIPQYGGSMAGNVVYPKDNSKGCKDFDS---SFKSRPGALPTILLLDRGSCFFALKVWNAQKAGASAVLVADDIEEPLITMDTPEEDVSSAKYIENITIPSALIGKSFGEKLKDAISGGDMVNVNLDWREAVPHPDDRVEYELWTNSNDECGVKCDMLIEFL 209          
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR7_ARATH (Vacuolar-sorting receptor 7 OS=Arabidopsis thaliana GN=VSR7 PE=2 SV=2)

HSP 1 Score: 221.476 bits (563), Expect = 3.150e-57
Identity = 105/210 (50.00%), Postives = 146/210 (69.52%), Query Frame = 2
Query:   35 REKLGFLVGILFLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            R  L FL+  L ++  +   RFVVEK S+ V +PE+++  ++ +I NFG+P YGG LIG+VVYP +    C  F +   +FK +    PT LL+DRG CYF LKAW+AQ+ GAAA+LVAD+  EPL+TMD+PEE      +++ +TIPS LI KS GD +++    G+ + + LDW E++PHPD+RVEYE WTNSNDECG +C+ Q+DFV
Sbjct:    7 RASLTFLLAALTIIAMVVEARFVVEKESISVLNPEEMRSKHDGSIANFGLPDYGGFLIGSVVYPDSKTDGCSAFGK---TFKPK-FPRPTILLLDRGGCYFALKAWHAQQAGAAAVLVADNVDEPLLTMDSPEESKDADGFIEKLTIPSVLIDKSFGDDLRQGFQKGKNIVIKLDWRESVPHPDKRVEYELWTNSNDECGARCDEQMDFV 212          
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR6_ARATH (Vacuolar-sorting receptor 6 OS=Arabidopsis thaliana GN=VSR6 PE=2 SV=2)

HSP 1 Score: 214.542 bits (545), Expect = 3.850e-55
Identity = 98/192 (51.04%), Postives = 138/192 (71.88%), Query Frame = 2
Query:   89 FGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            FGRF+VEK+S+ + +P  ++  ++ AI NFGVP YGG +IG+VVY       C  FD+   +FK +    PT L++DRG+CYF LK WN Q+ G AA+LVAD+  EPLITMD+PEE     ++++ + IPSALI  S  +++K++L  GE V + +DW+E+LPHPDERVEYE WTN+NDECG +C+ Q++FV
Sbjct:   24 FGRFIVEKSSVTILNPLAMRSKHDAAIANFGVPNYGGYMIGSVVYAGQGAYGCDSFDK---TFKPK-FPRPTILIIDRGECYFALKVWNGQQSGVAAVLVADNVDEPLITMDSPEESKEADDFIEKLNIPSALIDFSFANTLKQALKKGEEVVLKIDWSESLPHPDERVEYELWTNTNDECGARCDEQMNFV 211          
BLAST of FC869014 vs. ExPASy Swiss-Prot
Match: VSR5_ARATH (Vacuolar-sorting receptor 5 OS=Arabidopsis thaliana GN=VSR5 PE=2 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 8.876e-52
Identity = 99/215 (46.05%), Postives = 144/215 (66.98%), Query Frame = 2
Query:   20 SPAKMREKLGFLVGILFLLCGLSFGRFVVEKNSLKVTSPEKIKGVYECAIGNFGVPQYGGTLIGTVVYPKANQKACKGFDEVDLSFKSRPGGLPTFLLVDRGDCYFTLKAWNAQKGGAAAILVADDKTEPLITMDTPEEENADAEYLQNITIPSALISKSLGDSIKKSLSGGEMVNMNLDWTEALPHPDERVEYEFWTNSNDECGPKCESQIDFV 664
            SP+     L  ++ +  ++      RF VEK+SL V +  ++   ++ AI NFG+P+YGG +IG+VVY   +   C  F++   +F ++    P  LL+DRG C F LK WN Q+ GAAA+L+AD+  EPLITMDTP++E  D +++  + IPSALI +S GDS+KK+L  GE V + +DW+E++P+PDERVEYE W N+NDECG  C+ QIDF+
Sbjct:    2 SPSNKGTVLALILALTMVVVNGFSSRFFVEKSSLTVLNSWEMGAKHDAAIANFGLPKYGGFMIGSVVYAGQDAYGCNSFNK---TFNTK-SPYPKILLIDRGVCNFALKIWNGQQSGAAAVLLADNIVEPLITMDTPQDE--DPDFIDKVKIPSALILRSFGDSLKKALKRGEEVILKMDWSESIPNPDERVEYELWANTNDECGVHCDKQIDFI 210          
The following BLAST results are available for this feature:
BLAST of FC869014 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
VSR1_ARATH1.224e-9375.48Vacuolar-sorting receptor 1 OS=Arabidopsis thalian... [more]
VSR2_ARATH3.695e-8267.14Vacuolar-sorting receptor 2 OS=Arabidopsis thalian... [more]
VSR3_ARATH1.404e-8166.18Vacuolar-sorting receptor 3 OS=Arabidopsis thalian... [more]
VSR4_ARATH6.968e-8164.95Vacuolar-sorting receptor 4 OS=Arabidopsis thalian... [more]
VSR1_PEA2.242e-7966.35Vacuolar-sorting receptor 1 OS=Pisum sativum GN=BP... [more]
VSR7_ARATH3.150e-5750.00Vacuolar-sorting receptor 7 OS=Arabidopsis thalian... [more]
VSR6_ARATH3.850e-5551.04Vacuolar-sorting receptor 6 OS=Arabidopsis thalian... [more]
VSR5_ARATH8.876e-5246.05Vacuolar-sorting receptor 5 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007F02EF AbioticL1 Citrus clementina cDNA clone C31007F02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869014 ID=FC869014; Name=FC869014; organism=Citrus clementina; type=EST; length=664bp
GGAGGAGAAAGATTGAAAATCTCCTGCAAAGATGAGGGAAAAGCTAGGGT
TTTTGGTGGGTATTTTGTTTTTACTATGTGGTTTAAGTTTTGGAAGATTT
GTTGTGGAGAAAAATAGCTTGAAAGTGACATCCCCAGAGAAAATCAAAGG
AGTTTATGAATGTGCAATTGGGAATTTTGGGGTTCCTCAATATGGAGGAA
CTTTAATTGGTACCGTGGTTTATCCAAAAGCCAATCAAAAGGCTTGTAAG
GGTTTTGATGAAGTTGATCTTTCCTTCAAGTCAAGGCCTGGAGGATTACC
CACTTTTCTCCTTGTTGATCGAGGAGATTGTTACTTCACCTTGAAGGCCT
GGAATGCGCAAAAAGGTGGAGCTGCTGCTATTCTTGTGGCAGATGATAAG
ACTGAACCTTTGATTACCATGGACACCCCTGAAGAAGAGAATGCAGACGC
TGAATATCTACAAAACATCACCATTCCCTCAGCCCTTATAAGCAAATCTT
TGGGTGACAGTATCAAGAAGTCTCTAAGTGGTGGGGAAATGGTTAACATG
AATCTAGATTGGACAGAGGCTCTTCCGCATCCTGATGAGCGTGTGGAGTA
TGAATTCTGGACAAATAGCAACGATGAGTGCGGGCCNAAGTGTGAGAGCC
AGATTGATTTTGTT
back to top