FC869015

Overview
NameFC869015
Unique NameFC869015
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length709
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869015 vs. ExPASy Swiss-Prot
Match: PHAE_PHAVU (Erythroagglutinating phytohemagglutinin OS=Phaseolus vulgaris GN=DLEC1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.076e-11
Identity = 56/191 (29.32%), Postives = 76/191 (39.79%), Query Frame = 2
Query:  164 AVTPSYGYLSLTSDPSPESPDQLPLKKVGRVLYSQPVTAWP------AMISTTFTIRISPYPNTTDSADGMTFVFATDTSPPTEXXXXXXXXXXXXXXXXA----VELDTYKNDYWSDPDANHMGIDIANLTSNPAKSLDSSGIDLKSGRPIQVHIYYDGWTKILYVYVAYAGKPLQKLIERPIPLSETIP 706
            A   S G L LT+      P    L  +GR  YS P+  W       A   T+FT  I   PN +  ADG+ FV     S P +                A    VE DT  N +W DP   H+GID+     N  KS+ ++  D   G   +V I YD  TK+L   + Y       ++   + L   +P
Sbjct:   43 ATVSSKGQLRLTNVNDNGEPT---LSSLGRAFYSAPIQIWDNTTGAVAASPTSFTFNID-VPNNSGPADGLAFVLLPVGSQPKDKGGLLGLFNNYKYDSNAHTVAVEFDTLYNVHW-DPKPRHIGIDV-----NSIKSIKTTTWDFVKGENAEVLITYDSSTKLLVASLVYPSLKTSFIVSDTVDLKSVLP 223          
BLAST of FC869015 vs. ExPASy Swiss-Prot
Match: LEC1_MEDTR (Lectin 1 OS=Medicago truncatula GN=LEC1 PE=3 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.629e-11
Identity = 60/201 (29.85%), Postives = 90/201 (44.78%), Query Frame = 2
Query:  146 SLICMG-AVTPSYGYLSLTSDPSPESPDQLPLKKVGRVLYSQPVTAWP------AMISTTFTIRISPYPNTTDSADGMTFVFA-TDTSPPTEXXXXXXXXXXXXXXXX-----AVELDTYKNDYWSDPDAN-HMGIDIANLTSNPAKSLDSSGIDLKSGRPIQVHIYYDGWTKILYVYVAYAGKPLQKLIERPIPLSETIP 706
            +LI  G A+T S G L LT               +GR LYS P+  W       A   T FT  I+  P +++ ADG+ F  A  DT P                        AVE+DT+ N +  DP  N H+GI++     N  KS+ ++   L++GR   V + +D  T +L V ++Y G P   ++   +PL + +P
Sbjct:   47 NLIFQGNAITTSTGKLQLTKAVK---------NSIGRALYSAPIHIWDSKTGDVANFETLFTFAITA-PYSSNVADGLAFFIAPVDTQPQNIGRAGFLGVFNSETYNKSIQTVAVEIDTFHNTW--DPKINRHIGINV-----NCIKSISTTSWVLENGREANVLVRFDAHTNVLSVVLSYPGLPDSYILSDVVPLKDIVP 230          
BLAST of FC869015 vs. ExPASy Swiss-Prot
Match: PHAM_PHAVU (Leucoagglutinating phytohemagglutinin OS=Phaseolus vulgaris GN=PDLEC2 PE=3 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 8.658e-11
Identity = 58/196 (29.59%), Postives = 78/196 (39.80%), Query Frame = 2
Query:  146 SLICMG-AVTPSYGYLSLTSDPSPESPDQLPLKKVGRVLYSQPVTAWP------AMISTTFTIRISPYPNTTDSADGMTFVFATDTSPPTEXXXXXXXXXXXXXXXX--AVELDTYKNDYWSDPDANHMGIDIANLTSNPAKSLDSSGIDLKSGRPIQVHIYYDGWTKILYVYVAYAGKPLQKLIERPIPLSETIP 706
            +LI  G A   S G L LT+  S   P    +  +GR  YS P+  W       A   T FT  I   PN    ADG+ F      S P +                  AVE DT  N  W DP   H+GID+     N  KS+ ++  D  +G   +VHI Y+  TK+L   + Y        +   + L   +P
Sbjct:   36 NLILQGDASVSSSGQLRLTNVNSNGEPT---VGSLGRAFYSAPIQIWDYTTGNVASFDTNFTFNIL-VPNNAGPADGLAFALVPVGSQPKDKGGFLGLFDGSNSNFHTVAVEFDTLYNKDW-DPRERHIGIDV-----NSIKSIKTTPWDFVNGENAEVHITYESSTKLLVASLVYPSLKTSFTVSDTVDLKSVLP 221          
The following BLAST results are available for this feature:
BLAST of FC869015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
PHAE_PHAVU5.076e-1129.32Erythroagglutinating phytohemagglutinin OS=Phaseol... [more]
LEC1_MEDTR6.629e-1129.85Lectin 1 OS=Medicago truncatula GN=LEC1 PE=3 SV=1[more]
PHAM_PHAVU8.658e-1129.59Leucoagglutinating phytohemagglutinin OS=Phaseolus... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007F03EF AbioticL1 Citrus clementina cDNA clone C31007F03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869015 ID=FC869015; Name=FC869015; organism=Citrus clementina; type=EST; length=709bp
GTAGCCCTCAAATTTTCGTCCAAACAAAATGATTTTCCTACTACTCCTTT
CAATTTTTCTTCCCAGTGCTTCTTCATCAATCCCTGTGGATCCACCTGTT
AGCTTCTCATTTTCCTCATTCAACCCAAAAAGTTGTAGCGATGGCAGCCT
AATTTGCATGGGCGCAGTGACTCCAAGTTATGGCTACTTGAGCCTCACAT
CAGACCCTTCACCAGAATCGCCTGATCAGCTGCCGCTAAAAAAGGTTGGA
CGGGTTTTATACAGCCAGCCTGTGACTGCATGGCCAGCTATGATTAGTAC
CACCTTCACCATTAGGATCTCACCCTACCCAAATACAACGGATTCTGCAG
ATGGCATGACGTTTGTTTTTGCAACCGATACCAGCCCTCCAACTGAAAAC
TCCGCCGGCGGAAATCTTGGACTGAGTAACGGTGTTTCGCAATTAGCCGT
GGAGCTGGACACTTACAAGAACGACTACTGGTCTGATCCAGATGCTAACC
ATATGGGCATTGACATAGCAAACTTAACATCGAATCCAGCCAAGAGTCTC
GACAGCTCTGGTATTGATCTCAAAAGTGGAAGACCGATCCAGGTTCACAT
TTATTACGATGGATGGACGAAAATACTCTATGTTTATGTGGCATATGCGG
GGAAACCACTTCAGAAGCTTATTGAAAGACCTATCCCCTTGTCAGAAACA
ATTCCAGCT
back to top