FC869017

Overview
NameFC869017
Unique NameFC869017
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length751
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 398.667 bits (1023), Expect = 1.805e-110
Identity = 194/230 (84.35%), Postives = 202/230 (87.83%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MATSAIQQSAFAGQTAL+QSNE V K+G   GGR++MRRTVKS P SIWYGPDRPKYLGPFS+Q PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKE+KNGRLAMFS  GFFVQ
Sbjct:    1 MATSAIQQSAFAGQTALKQSNELVCKIGAVGGGRVSMRRTVKSAPTSIWYGPDRPKYLGPFSDQIPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQ 230          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB26_PETSP (Chlorophyll a-b binding protein 37, chloroplastic OS=Petunia sp. GN=CAB37 PE=3 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 3.764e-108
Identity = 192/230 (83.48%), Postives = 199/230 (86.52%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MATSAIQQSAFAGQTAL+  NE VRK+G   GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  GFFVQ
Sbjct:    1 MATSAIQQSAFAGQTALKSQNELVRKIGSFGGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQ 230          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 389.423 bits (999), Expect = 1.095e-107
Identity = 189/230 (82.17%), Postives = 200/230 (86.96%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MATSAI+QSAFAGQTAL+  NE VRK+G  +GGR TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WA QVVLMG +EGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  GFFVQ
Sbjct:    1 MATSAIEQSAFAGQTALKSQNELVRKIGSFNGGRATMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQ 230          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 5.435e-107
Identity = 189/230 (82.17%), Postives = 197/230 (85.65%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MAT AIQQSAF GQ   +  NEF+RKVG    GRITMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWACQVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  GFFVQ
Sbjct:    1 MATCAIQQSAFVGQAVGKSQNEFIRKVGNFGEGRITMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQ 230          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 384.8 bits (987), Expect = 2.697e-106
Identity = 188/230 (81.74%), Postives = 196/230 (85.22%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MATSAIQQSAF G+T LRQ NEF+RK G     R TMRRTVKS P+SIWYGPDRPKYLGPFSEQ PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGC FPE+L KNGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFS  GFFVQ
Sbjct:    1 MATSAIQQSAFTGKTGLRQGNEFIRKRGNFGQARFTMRRTVKSAPESIWYGPDRPKYLGPFSEQIPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQ 230          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB21_LEMGI (Chlorophyll a-b binding protein of LHCII type I, chloroplastic OS=Lemna gibba PE=3 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 1.025e-105
Identity = 187/230 (81.30%), Postives = 201/230 (87.39%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MA SAIQ SAFAGQTAL+Q +E VRKVGV+DG R +MRRTVK+ PQSIWYG DRPK+LGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGC+FPE+LSKNGV+FGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMG +EGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  GFFVQ
Sbjct:    1 MAASAIQSSAFAGQTALKQRDELVRKVGVSDG-RFSMRRTVKAVPQSIWYGADRPKFLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCIFPELLSKNGVQFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVVLMGLIEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQ 229          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.363e-102
Identity = 188/230 (81.74%), Postives = 197/230 (85.65%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFS  GFFVQ
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQ 228          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.363e-102
Identity = 188/230 (81.74%), Postives = 197/230 (85.65%), Query Frame = 1
Query:   61 MATSAIQQSAFAGQTALRQSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MA SA+ Q+     TA R+ +E VR+VG + GGRITMRRTVKS PQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFS  GFFVQ
Sbjct:    1 MAASALHQTTSFLGTAPRR-DELVRRVGDS-GGRITMRRTVKSAPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQ 228          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 2.889e-100
Identity = 183/232 (78.88%), Postives = 195/232 (84.05%), Query Frame = 1
Query:   61 MAT-SAIQQSAFAGQTALR-QSNEFVRKVGVADGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            MAT SAIQ S+ AGQT LR Q NE V+KVG A   RITMRRTV+S P+SIWYGPDRPKYLGPFSE TPSYLTGEFPGDYGWDTA +SADPETFAKNRELEVIH RWAMLGALGCVFPE+L+KNG+KFGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWACQVVLMG +EGYR+                AFDPLGLADDP+  AELKVKE+KNGRLAMFS  GFFVQ
Sbjct:    1 MATASAIQSSSLAGQTLLRPQQNELVKKVGTAQA-RITMRRTVRSAPESIWYGPDRPKYLGPFSEGTPSYLTGEFPGDYGWDTAAVSADPETFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPLGLADDPEACAELKVKEIKNGRLAMFSMFGFFVQ 231          
BLAST of FC869017 vs. ExPASy Swiss-Prot
Match: CB25_SOLLC (Chlorophyll a-b binding protein 5, chloroplastic (Fragment) OS=Solanum lycopersicum GN=CAB5 PE=2 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.316e-96
Identity = 169/200 (84.50%), Postives = 176/200 (88.00%), Query Frame = 1
Query:  151 DGGRITMRRTVKSTPQSIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSHVGFFVQ 750
            +GGR+TMRRTVKS PQSIWYG DRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLGALGCVFPEILSKNGV FGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWA QVVLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFS  GFFVQ
Sbjct:    3 EGGRVTMRRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWASQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQ 202          
The following BLAST results are available for this feature:
BLAST of FC869017 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
CB21_GOSHI1.805e-11084.35Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB26_PETSP3.764e-10883.48Chlorophyll a-b binding protein 37, chloroplastic ... [more]
CB23_TOBAC1.095e-10782.17Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB24_SOLLC5.435e-10782.17Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB215_PEA2.697e-10681.74Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB21_LEMGI1.025e-10581.30Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB23_ORYSJ2.363e-10281.74Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI2.363e-10281.74Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB21_PINTH2.889e-10078.88Chlorophyll a-b binding protein type I, chloroplas... [more]
CB25_SOLLC4.316e-9684.50Chlorophyll a-b binding protein 5, chloroplastic (... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007F05EF AbioticL1 Citrus clementina cDNA clone C31007F05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869017 ID=FC869017; Name=FC869017; organism=Citrus clementina; type=EST; length=751bp
ATATTCAGAGTGCGAAAAGAATCTTCAGCAACAAAAGGAAAAGCTTTCGC
ATAAGAACATATGGCAACCTCTGCTATCCAACAATCAGCATTTGCTGGCC
AGACCGCCTTGAGGCAATCCAATGAGTTTGTCCGCAAGGTTGGAGTTGCT
GACGGTGGCCGTATCACCATGAGGAGGACTGTCAAATCCACTCCCCAGAG
CATCTGGTACGGCCCAGACCGCCCAAAGTACTTGGGACCATTCTCTGAGC
AAACACCATCATACTTGACTGGTGAGTTCCCTGGTGACTATGGCTGGGAT
ACCGCTGGTTTATCAGCAGACCCCGAGACATTTGCTAAGAACCGTGAGCT
AGAGGTGATCCACAGCAGATGGGCAATGCTTGGAGCTCTTGGCTGCGTCT
TCCCTGAAATCCTCTCCAAGAATGGAGTGAAGTTCGGCGAAGCAGTTTGG
TTCAAGGCTGGCGCTCAAATCTTCTCTGAAGGTGGCCTTGACTATCTTGG
CAACCCCAACCTCATTCATGCTCAGAGCATTTTGGCTATCTGGGCCTGCC
AGGTTGTGCTCATGGGTTTTGTTGAAGGATACAGAATTGGTGGCGGTCCT
CTTGGTGAAGGACTTGACCCACTTTACCCTGGTGGTGCTTTTGACCCACT
TGGTTTGGCCGATGACCCCGATCAATTTGCTGAGTTGAAGGTCAAGGAGC
TCAAGAATGGCCGTCTGGCTATGTTCTCCCATGTTGGATTCTTTGTTCAG
G
back to top