FC869027

Overview
NameFC869027
Unique NameFC869027
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length635
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: IDND_VITVI (L-idonate 5-dehydrogenase OS=Vitis vinifera GN=GSVIVT00012394001 PE=1 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 8.950e-83
Identity = 145/188 (77.13%), Postives = 167/188 (88.83%), Query Frame = 3
Query:   81 MGKGGMSQGE---KKDGEEVNMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNV 635
            MGKGG S+     K+ GEE NMAAWL+G+ TLKIQP+ LPSLGPYDV VR+KAVGICGSDVH+ KT+RCA+F+VK+PMVIGHECAG+IE+VGSEVK LV GDRVALEPGISC RC  C+ G+YNLC EMKFF +PP +GSLAN+VVHP++LCFKLPDNVSLEEGAMCEPLSVG+HACRRAN+GPETNV
Sbjct:    1 MGKGGNSEDAVSGKEHGEE-NMAAWLLGIKTLKIQPYILPSLGPYDVKVRIKAVGICGSDVHHFKTMRCANFIVKKPMVIGHECAGIIEEVGSEVKNLVAGDRVALEPGISCNRCSLCRNGQYNLCREMKFFGSPPTNGSLANQVVHPSNLCFKLPDNVSLEEGAMCEPLSVGIHACRRANVGPETNV 187          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_MACFA (Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3)

HSP 1 Score: 184.882 bits (468), Expect = 3.007e-46
Identity = 87/162 (53.70%), Postives = 115/162 (70.99%), Query Frame = 3
Query:  132 NMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            N++  + G   L+++ + +P  GP +VL+RM +VGICGSDVHY +  R  +F+VK+PMV+GHE +G +EKVGS VK L PGDRVA+EPG+     + CK GRYNL P + F ATPP  G+L     H A  C+KLPDNV+ EEGA+ EPLSVG+HACRR  +
Sbjct:    9 NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEEGRIGNFIVKKPMVLGHEASGTVEKVGSLVKHLKPGDRVAIEPGVPRENDEFCKSGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGV 170          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_MOUSE (Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3)

HSP 1 Score: 183.726 bits (465), Expect = 6.699e-46
Identity = 87/162 (53.70%), Postives = 117/162 (72.22%), Query Frame = 3
Query:  132 NMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            N++  + G   ++++ + +P LGP DVL++M +VGICGSDVHY +  R  DFVVK+PMV+GHE AG + KVG  VK L PGDRVA+EPG+     ++CK GRYNL P + F ATPP  G+L     H AD C+KLPD+V+ EEGA+ EPLSVG++ACRR ++
Sbjct:    9 NLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGELVKHLKPGDRVAIEPGVPREVDEYCKIGRYNLTPTIFFCATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSV 170          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_RAT (Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4)

HSP 1 Score: 183.341 bits (464), Expect = 8.750e-46
Identity = 87/162 (53.70%), Postives = 116/162 (71.60%), Query Frame = 3
Query:  132 NMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            N++  + G   ++++ + +P LGP DVL++M +VGICGSDVHY +  R  DFVVK+PMV+GHE AG + KVG  VK L PGDRVA+EPG+     + CK GRYNL P + F ATPP  G+L     H AD C+KLPD+V+ EEGA+ EPLSVG++ACRR ++
Sbjct:    9 NLSLVVHGPGDIRLENYPIPELGPNDVLLKMHSVGICGSDVHYWEHGRIGDFVVKKPMVLGHEAAGTVTKVGPMVKHLKPGDRVAIEPGVPREIDEFCKIGRYNLTPSIFFCATPPDDGNLCRFYKHSADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSV 170          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_PONAB (Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 1.143e-45
Identity = 88/162 (54.32%), Postives = 114/162 (70.37%), Query Frame = 3
Query:  132 NMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            N++  + G   L+++ + +P  GP +VL+RM +VGICGSDVHY +  R  +F+VK+PMV+GHE +G +EKVGS VK L PGDRVA+EPG      + CK GRYNL P + F ATPP  G+L     H A  C+KLPDNV+ EEGAM EPLSVG+HACRR  +
Sbjct:    9 NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEDGRIGNFIVKKPMVLGHEASGTVEKVGSLVKHLKPGDRVAIEPGAPRENDEFCKIGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGAMIEPLSVGIHACRRGGV 170          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_HUMAN (Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=3)

HSP 1 Score: 182.956 bits (463), Expect = 1.143e-45
Identity = 87/162 (53.70%), Postives = 114/162 (70.37%), Query Frame = 3
Query:  132 NMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            N++  + G   L+++ + +P  GP +VL+RM +VGICGSDVHY +  R  +F+VK+PMV+GHE +G +EKVGS VK L PGDRVA+EPG      + CK GRYNL P + F ATPP  G+L     H A  C+KLPDNV+ EEGA+ EPLSVG+HACRR  +
Sbjct:    9 NLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGV 170          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_BOVIN (Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3)

HSP 1 Score: 180.644 bits (457), Expect = 5.671e-45
Identity = 87/162 (53.70%), Postives = 115/162 (70.99%), Query Frame = 3
Query:  132 NMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            N++  + G   L+++ + +P  GP +VL++M +VGICGSDVHY +  R  DFVVK+PMV+GHE +G + KVGS V+ L PGDRVA+EPG      + CK GRYNL P + F ATPP  G+L     H A+ C+KLPDNV+ EEGA+ EPLSVG+HACRRA +
Sbjct:    8 NLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGV 169          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_SHEEP (Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 8.190e-44
Identity = 86/162 (53.09%), Postives = 115/162 (70.99%), Query Frame = 3
Query:  132 NMAAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            N++  + G   L+++ + +P  GP +VL++M +VGICGSDVHY +  R  DFVVK+PMV+GHE +G + KVGS V+ L PGDRVA++PG      + CK GRYNL P + F ATPP  G+L     H A+ C+KLPDNV+ EEGA+ EPLSVG+HACRRA +
Sbjct:    7 NLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQG-RIGDFVVKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIQPGAPRQTDEFCKIGRYNLSPTIFFCATPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGV 167          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_BACSU (Sorbitol dehydrogenase OS=Bacillus subtilis GN=gutB PE=1 SV=3)

HSP 1 Score: 169.088 bits (427), Expect = 1.708e-41
Identity = 76/166 (45.78%), Postives = 109/166 (65.66%), Query Frame = 3
Query:  138 AAWLMGVNTLKIQPFELPSLGPYDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNV 635
            AA +     +KI+   +P +   +VL+++ AVGICGSD+HY    R  ++VV++P ++GHECAG I  VGS V     GDRVA+EPG++C RC+ CK GRYNLCP+++F ATPPV G+    +    D  F +PD++S EE A+ EP SVG+HA  R  + P + +
Sbjct:   11 AAVMHNTREIKIETLPVPDINHDEVLIKVMAVGICGSDLHYYTNGRIGNYVVEKPFILGHECAGEIAAVGSSVDQFKVGDRVAVEPGVTCGRCEACKEGRYNLCPDVQFLATPPVDGAFVQYIKMRQDFVFLIPDSLSYEEAALIEPFSVGIHAAARTKLQPGSTI 176          
BLAST of FC869027 vs. ExPASy Swiss-Prot
Match: DHSO_SCHPO (Putative sorbitol dehydrogenase OS=Schizosaccharomyces pombe GN=tms1 PE=2 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.598e-39
Identity = 74/138 (53.62%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  204 YDVLVRMKAVGICGSDVHYLKTLRCADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISCWRCDHCKGGRYNLCPEMKFFATPPVHGSLANRVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANI 617
            + V V +KA GICGSDVHY K     DF++K+PM++GHE AGV+ +VG  V +L PGD VA+EPG  C  CD+C+ GRYNLCP M+F ATPP  G+L    +   D C KLP  +S+EEGA+ EP+SV +HA  R N+
Sbjct:   30 HQVKVAIKATGICGSDVHYWKEGGIGDFILKKPMILGHESAGVVVEVGKGVSSLKPGDPVAVEPGCVCRLCDYCRSGRYNLCPHMEFAATPPYDGTLRTYYITTEDFCTKLPKQISVEEGALFEPMSVAVHAMTRGNL 167          
The following BLAST results are available for this feature:
BLAST of FC869027 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 234
Match NameE-valueIdentityDescription
IDND_VITVI8.950e-8377.13L-idonate 5-dehydrogenase OS=Vitis vinifera GN=GSV... [more]
DHSO_MACFA3.007e-4653.70Sorbitol dehydrogenase OS=Macaca fascicularis GN=S... [more]
DHSO_MOUSE6.699e-4653.70Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=... [more]
DHSO_RAT8.750e-4653.70Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sor... [more]
DHSO_PONAB1.143e-4554.32Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=... [more]
DHSO_HUMAN1.143e-4553.70Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=... [more]
DHSO_BOVIN5.671e-4553.70Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 ... [more]
DHSO_SHEEP8.190e-4453.09Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 ... [more]
DHSO_BACSU1.708e-4145.78Sorbitol dehydrogenase OS=Bacillus subtilis GN=gut... [more]
DHSO_SCHPO1.598e-3953.62Putative sorbitol dehydrogenase OS=Schizosaccharom... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007G03EF AbioticL1 Citrus clementina cDNA clone C31007G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869027 ID=FC869027; Name=FC869027; organism=Citrus clementina; type=EST; length=635bp
AATATATCGTAGCTTAAAATGTTGTGTACAGAGTGAAGTCTCTTCTGTGC
ACTTGTGTTTTTGAAGGGTAAAAAGCAAATATGGGCAAAGGAGGGATGTC
ACAAGGAGAAAAGAAGGATGGAGAAGAAGTTAACATGGCAGCTTGGCTTA
TGGGTGTCAACACCCTCAAGATTCAACCTTTTGAGCTTCCTTCTCTGGGA
CCATATGATGTTTTAGTCAGGATGAAAGCCGTTGGTATTTGTGGAAGTGA
TGTGCATTATCTCAAGACCTTGAGGTGTGCCGATTTTGTTGTGAAAGAGC
CTATGGTGATTGGGCACGAGTGTGCTGGGGTCATAGAGAAGGTGGGAAGC
GAGGTGAAGACTTTGGTGCCCGGTGACCGTGTGGCCCTGGAACCCGGGAT
CAGCTGCTGGCGATGTGATCACTGCAAAGGAGGTCGATACAATTTGTGTC
CAGAGATGAAATTTTTTGCAACTCCGCCCGTTCATGGTTCCCTGGCTAAT
CGGGTGGTGCATCCTGCAGACCTATGTTTTAAGCTGCCGGACAATGTGAG
CCTGGAGGAAGGGGCTATGTGTGAGCCCTTGAGTGTTGGTCTTCATGCCT
GCCGCCGTGCCAATATCGGTCCTGAGACAAATGTG
back to top