FC869037

Overview
NameFC869037
Unique NameFC869037
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length679
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869037 vs. ExPASy Swiss-Prot
Match: ZN207_HUMAN (Zinc finger protein 207 OS=Homo sapiens GN=ZNF207 PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.293e-29
Identity = 53/75 (70.67%), Postives = 64/75 (85.33%), Query Frame = 3
Query:  159 WCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHKENVTKVPNAKPGRESTDIEIYGMQGIP 383
            WC+YC+R+FDDEKIL+QHQKAKHFKCH+CHKKL T  G+AIH +QVHKE +  VPNA PGR   ++EIYGM+GIP
Sbjct:   12 WCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIP 86          
BLAST of FC869037 vs. ExPASy Swiss-Prot
Match: ZN207_PONAB (Zinc finger protein 207 OS=Pongo abelii GN=ZNF207 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 2.881e-29
Identity = 53/75 (70.67%), Postives = 63/75 (84.00%), Query Frame = 3
Query:  159 WCYYCDREFDDEKILVQHQKAKHFKCHVCHKKLSTAGGMAIHVLQVHKENVTKVPNAKPGRESTDIEIYGMQGIP 383
            WC+YC+R+FDDEKIL QHQKAKHFKCH+CHKKL T  G+AIH +QVHKE +  VPNA PGR   ++EIYGM+GIP
Sbjct:   12 WCWYCNRDFDDEKILTQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIP 86          
The following BLAST results are available for this feature:
BLAST of FC869037 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
ZN207_HUMAN1.293e-2970.67Zinc finger protein 207 OS=Homo sapiens GN=ZNF207 ... [more]
ZN207_PONAB2.881e-2970.67Zinc finger protein 207 OS=Pongo abelii GN=ZNF207 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31007H01EF AbioticL1 Citrus clementina cDNA clone C31007H01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869037 ID=FC869037; Name=FC869037; organism=Citrus clementina; type=EST; length=679bp
GCAGAGATCGAGAGAGGGGAGTCACAGTAGGAAACCCTAATAAATCAATC
GAGCGAGAACGAGAGTGATTTTGATAATTTTTTTTTTTTAAGGCAAATAG
AGAGAAACAGGGAAGGGCAAAGATGGGAAAGAAGAAGAAGAGAGTATCGT
CGAAGGTTTGGTGCTATTACTGCGACAGGGAATTCGATGACGAAAAGATT
TTAGTACAACATCAGAAAGCTAAGCACTTCAAGTGCCACGTGTGCCACAA
GAAGCTCTCCACCGCCGGCGGCATGGCCATTCACGTCCTTCAGGTTCACA
AAGAGAATGTCACCAAAGTACCTAATGCAAAACCAGGTCGAGAGTCGACC
GACATTGAAATTTATGGAATGCAAGGAATACCACCTGATGTCTTAGCTGC
TCATTATGGAGAAGAAGAAGAAGAAGTTCCATCTAAAATGGCCAAAGTGG
ATACTTCTTTCCCACAGCTGGTAGGTGGGGTGGTGCCAGGACAATTGGGT
GTCAGCTATCCTCCTCAATCAACTTTAGGCATGATGCAGCCAATTTACAG
TTCTGCAGTTCCCGTGCCTCCTGCTGGTTGGCCAGTGCCTCCTCGTCCTC
AACCCTGGTATCCACAGCATGCAGCAGTTTCAATTCCCCCACCTGCTGCA
GTGGGTTATGCTCAACAGCCTTTATTTCC
back to top