FC869039

Overview
NameFC869039
Unique NameFC869039
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length718
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9450 contig Ccv1_Contig9450:1..718. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSKP_SOLTU (Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 1.282e-78
Identity = 159/219 (72.60%), Postives = 177/219 (80.82%), Query Frame = 1
Query:   67 SSLVCSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSV--KPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            +S + +PLT+ LC +K       K+      +          KV++    SVVCKAVSV  K  T IEGLNIAEDVTQLIG TPMVYLNTI KGCVANIAAKLEIMEPCCSVKDRIGFSMI DAE+KGLI+PGK++LVEPTSGNTGIGLAFIAAS+GYKLILTMPASMSLERRV+LKAFGAELVLTD  KGMKGAV KAEEILN+TP+AY+LQQFDNPA
Sbjct:    2 ASFINNPLTS-LCNTKSERNNLFKISLYEAQSLGFSKLNGSRKVAFP---SVVCKAVSVPTKSSTEIEGLNIAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPA 216          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSKP_CAPAN (Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 2.856e-78
Identity = 150/169 (88.76%), Postives = 160/169 (94.67%), Query Frame = 1
Query:  217 SVVCKAVSV--KPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            SVVCKAVSV  K  T IEGLNIAEDVTQLIG TPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMI+DAE+KGLI+PGK++LVEPTSGNTGIGLAFIAAS+GYKLILTMPASMSLERRV+LKAFGAELVLTD  KGMKGAV KAEEILN+TP+AY+LQQFDNPA
Sbjct:   46 SVVCKAVSVQTKSPTEIEGLNIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPA 214          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSKP_ARATH (Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 6.363e-78
Identity = 153/220 (69.55%), Postives = 180/220 (81.82%), Query Frame = 1
Query:   61 TSSSLVCSPLTAPLCISKKS-SLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            +SS+ + +PLT+     K S  L++L L   S   AA  +    + +  +  + VVCKAVS+KP+ G+EGLNIA++  QLIGKTPMVYLN +VKGCVA++AAKLEIMEPCCSVKDRIG+SMI DAE+KGLITPGKS+LVE TSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLL+AFGAELVLT+  KGM GA+QKAEEIL  TPN+YMLQQFDNPA
Sbjct:    5 SSSAFLLNPLTSRHRPFKYSPELSSLSLS--SRKAAAFDVSSAAFTLKRQSRSDVVCKAVSIKPEAGVEGLNIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYSMITDAEEKGLITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAFGAELVLTEPAKGMTGAIQKAEEILKKTPNSYMLQQFDNPA 222          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSKM_ARATH (Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3)

HSP 1 Score: 282.337 bits (721), Expect = 1.733e-75
Identity = 150/225 (66.67%), Postives = 179/225 (79.56%), Query Frame = 1
Query:   61 TSSSLVCSPLTAPLCISK------KSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            +SS+L+ +PLT+    S          +++L     S  + A + +   +    +   SVVC+AV  K +TG +GLNIA++V+QLIGKTPMVYLN+I KGCVANIAAKLEIMEPCCSVKDRIG+SM+ DAEQKG I+PGKS+LVEPTSGNTGIGLAFIAAS+GY+LILTMPASMS+ERRVLLKAFGAELVLTD  KGM GAVQKAEEIL +TP+AYMLQQFDNPA
Sbjct:   38 SSSALLLNPLTSSSSSSTLRRFRCSPEISSLSFSSASDFSLAMKRQSRSFADGSERDPSVVCEAV--KRETGPDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPA 260          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSKP_SPIOL (Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2)

HSP 1 Score: 278.485 bits (711), Expect = 2.502e-74
Identity = 146/209 (69.86%), Postives = 170/209 (81.34%), Query Frame = 1
Query:   91 TAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            T+ L + +  +LA  ++G  S ++       N  KVS  P   + CKAVS+ P + IEGLNIAEDV+QLIGKTPMVYLN + KG VANIAAKLE MEPCCSVKDRIG+SMI DAEQKG+ITPGK+ LVEPTSGNTGIGLAFIAA++GYK+ LTMPASMS+ERRV+LKAFGAELVLTD  KGMKGAV+KAEEIL  TP++YMLQQFDNPA
Sbjct:   14 TSKLELREVKNLANFRVGPPSSLSC-----NNFKKVSSSP---ITCKAVSLSPPSTIEGLNIAEDVSQLIGKTPMVYLNNVSKGSVANIAAKLESMEPCCSVKDRIGYSMIDDAEQKGVITPGKTTLVEPTSGNTGIGLAFIAAARGYKITLTMPASMSMERRVILKAFGAELVLTDPAKGMKGAVEKAEEILKKTPDSYMLQQFDNPA 214          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSK_SPIOL (Cysteine synthase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 8.921e-64
Identity = 118/148 (79.73%), Postives = 136/148 (91.89%), Query Frame = 1
Query:  274 IAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            IA+DVT+LIGKTP+VYLNT+  GCVA +AAKLE MEPC SVKDRIGFSMI DAE+ GLITPG+S+L+EPTSGNTGIGLAFIAA+KGYKLI+TMPASMSLERR +L+AFGAEL+LTD  KGMKGAVQKAEEI + TPN+Y+LQQF+NPA
Sbjct:    8 IAKDVTELIGKTPLVYLNTVADGCVARVAAKLEGMEPCSSVKDRIGFSMITDAEKSGLITPGESVLIEPTSGNTGIGLAFIAAAKGYKLIITMPASMSLERRTILRAFGAELILTDPAKGMKGAVQKAEEIRDKTPNSYILQQFENPA 155          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSK2_ORYSJ (Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 2.870e-62
Identity = 116/151 (76.82%), Postives = 134/151 (88.74%), Query Frame = 1
Query:  265 GLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            G +IA DVT LIG TP+VYLN +V GC A IAAKLEIMEPC SVKDRIG+SMI DAE+KGLITPGKS+L+EPTSGNTGIGLAF+AA+KGYKLILTMPASMS+ERR++LKAFGAELVLTD   GMKGA+QKA+E+    PN+Y+LQQF+NPA
Sbjct:    5 GQSIASDVTALIGNTPLVYLNKVVDGCEAQIAAKLEIMEPCSSVKDRIGYSMITDAEEKGLITPGKSVLIEPTSGNTGIGLAFMAAAKGYKLILTMPASMSMERRIILKAFGAELVLTDPLLGMKGAIQKADELAAKMPNSYILQQFENPA 155          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSK_CITLA (Cysteine synthase OS=Citrullus lanatus PE=2 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.748e-62
Identity = 115/148 (77.70%), Postives = 135/148 (91.22%), Query Frame = 1
Query:  274 IAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            IA+DVT+LIG TP+VYLN +V GCVA +AAKLE+MEPC SVKDRIG+SMI+DAE KGLITPG+S+L+EPTSGNTGIGLAFIAA+KGY+LI+ MPASMSLERR +L+AFGAELVLTD  +GMKGAVQKAEEI   TPN+Y+LQQF+NPA
Sbjct:    8 IAKDVTELIGNTPLVYLNRVVDGCVARVAAKLEMMEPCSSVKDRIGYSMISDAENKGLITPGESVLIEPTSGNTGIGLAFIAAAKGYRLIICMPASMSLERRTILRAFGAELVLTDPARGMKGAVQKAEEIKAKTPNSYILQQFENPA 155          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSK1_BRAJU (Cysteine synthase OS=Brassica juncea PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 8.350e-62
Identity = 113/148 (76.35%), Postives = 132/148 (89.19%), Query Frame = 1
Query:  274 IAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            IA+DVT+LIG TP+VYLN + +GCV  +AAKLE+MEPC SVKDRIGFSMI+DAEQKGLI PG+S+L+EPTSGNTG+GLAF AA+KGYKLI+TMPASMS+ERR++L AFG ELVLTD  KGMKGA+ KAEEIL  TPN YMLQQF+NPA
Sbjct:    5 IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEQKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPA 152          
BLAST of FC869039 vs. ExPASy Swiss-Prot
Match: CYSK2_BRAJU (Cysteine synthase OS=Brassica juncea PE=2 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.090e-61
Identity = 112/150 (74.67%), Postives = 133/150 (88.67%), Query Frame = 1
Query:  268 LNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSXKGMKGAVQKAEEILNSTPNAYMLQQFDNPA 717
            + IA DVT+LIG TP+VYLN++ +GCV  +AAKLE+MEPC SVKDRIGFSMI+DAE+KGLI PG+S+L+EPTSGNTG+GLAF AA+KGYKLI+TMPASMS+ERR++L AFG ELVLTD  KGMKGA+ KAEEIL  TPN YMLQQF+NPA
Sbjct:    5 IGIANDVTELIGNTPLVYLNSVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPA 154          
The following BLAST results are available for this feature:
BLAST of FC869039 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
CYSKP_SOLTU1.282e-7872.60Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSKP_CAPAN2.856e-7888.76Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSKP_ARATH6.363e-7869.55Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSKM_ARATH1.733e-7566.67Cysteine synthase, mitochondrial OS=Arabidopsis th... [more]
CYSKP_SPIOL2.502e-7469.86Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSK_SPIOL8.921e-6479.73Cysteine synthase OS=Spinacia oleracea PE=1 SV=1[more]
CYSK2_ORYSJ2.870e-6276.82Cysteine synthase OS=Oryza sativa subsp. japonica ... [more]
CYSK_CITLA3.748e-6277.70Cysteine synthase OS=Citrullus lanatus PE=2 SV=1[more]
CYSK1_BRAJU8.350e-6276.35Cysteine synthase OS=Brassica juncea PE=2 SV=1[more]
CYSK2_BRAJU1.090e-6174.67Cysteine synthase OS=Brassica juncea PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007H03EF AbioticL1 Citrus clementina cDNA clone C31007H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869039 ID=FC869039|Name=FC869039|organism=Citrus clementina|type=EST|length=718bp
GGTAGCATCATCAGTTGGTCGTCAGACAGTTAGTCCCACAAAGTTCCAAA
AACAATGGCCACTTCGTCTTCTCTGGTGTGCAGTCCGTTGACTGCTCCTC
TCTGCATCTCCAAGAAATCATCATTGGCCACTCTGAAACTGGGCTACATT
AGCCCCATAACAGCAGCTCGAAGATTGAAGCAGAATTTGTACAAGGTCTC
TTACAAACCCTGCAACTCTGTTGTGTGCAAGGCTGTCTCTGTGAAGCCGC
AGACTGGGATTGAAGGTCTCAACATTGCTGAAGATGTCACTCAGCTTATT
GGGAAGACGCCAATGGTATACCTGAATACTATTGTCAAGGGGTGTGTTGC
AAACATTGCTGCCAAGCTTGAAATCATGGAACCATGTTGTAGTGTTAAGG
ACAGGATTGGTTTCAGTATGATAGCTGATGCCGAGCAAAAAGGACTAATA
ACGCCTGGAAAGAGTATTCTTGTAGAGCCCACTAGTGGAAACACTGGAAT
TGGCCTTGCTTTCATAGCTGCTTCGAAAGGATATAAGCTCATTTTGACTA
TGCCAGCCTCAATGAGCTTGGAAAGGAGAGTTCTTCTGAAAGCATTTGGA
GCTGAGCTTGTATTAACTGATTCAGNCAAAGGCATGAAGGGGGCTGTGCA
GAAAGCTGAAGAAATTTTGAATAGCACACCTAATGCATATATGCTTCAGC
AATTTGACAATCCTGCTA
back to top