FC869045

Overview
NameFC869045
Unique NameFC869045
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14114 contig Ccv1_Contig14114:3..707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC_SPIOL (Fructose-bisphosphate aldolase, chloroplastic OS=Spinacia oleracea PE=1 SV=3)

HSP 1 Score: 305.834 bits (782), Expect = 1.423e-82
Identity = 154/181 (85.08%), Postives = 164/181 (90.61%), Query Frame = 1
Query:  142 PVLDKSEWVKGQAIR-QSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            PVLD  E++KGQ +R  S   VR  PSG SSLT+RA SYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLL++APGLGQY+SGAILFEETLYQSTTDGKKMVDVL+EQ IVP IKVDKG +PL GSNDESWCQGLDGLA R+AAYYQQGARFAKWRTVVSIP
Sbjct:   11 PVLDNPEFLKGQTLRIPSVAGVRFTPSGSSSLTVRASSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLISAPGLGQYVSGAILFEETLYQSTTDGKKMVDVLIEQGIVPGIKVDKGWLPLPGSNDESWCQGLDGLACRSAAYYQQGARFAKWRTVVSIP 191          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC1_ARATH (Probable fructose-bisphosphate aldolase 1, chloroplastic OS=Arabidopsis thaliana GN=FBA1 PE=1 SV=2)

HSP 1 Score: 296.204 bits (757), Expect = 1.127e-79
Identity = 153/180 (85.00%), Postives = 163/180 (90.56%), Query Frame = 1
Query:  154 KSEWVKGQAI---RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            KS+WVKGQ++   + S+VS       PS+LT+RA S YADELVKTAKT+ASPG GI+AMDESNATCGKRLASIGLENTEANRQAYRTLLV+APGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVP IKVDKGLVPL GS DESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP
Sbjct:   15 KSDWVKGQSLLLRQPSSVSAIRSHVAPSALTVRAASAYADELVKTAKTIASPGHGIMAMDESNATCGKRLASIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPGIKVDKGLVPLVGSYDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 194          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC2_ARATH (Probable fructose-bisphosphate aldolase 2, chloroplastic OS=Arabidopsis thaliana GN=FBA2 PE=1 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 1.923e-79
Identity = 153/183 (83.61%), Postives = 167/183 (91.26%), Query Frame = 1
Query:  142 PVLDKSEWVKGQAI--RQSTVSVRSLPSGPSSLTIRAGS-YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            PVLDKSEWVKGQ++  RQ + +   L +  +SLT+RA S YADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLV+APGLGQY+SGAILFEETLYQSTT+GKKMVDVLVEQNIVP IKVDKGLVPL GSN+ESW QGLDGL+SRTAAYYQQGARFAKWRTVVSIP
Sbjct:   11 PVLDKSEWVKGQSVLFRQPSSASVVLRNRATSLTVRAASSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAFRTLLVSAPGLGQYVSGAILFEETLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWGQGLDGLSSRTAAYYQQGARFAKWRTVVSIP 193          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC1_PEA (Fructose-bisphosphate aldolase 1, chloroplastic (Fragment) OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.401e-75
Identity = 138/150 (92.00%), Postives = 146/150 (97.33%), Query Frame = 1
Query:  232 LTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            LTIRAGSYADELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTE NRQA+RTLLVT P LG+YISGAILFEETLYQSTTDG+K+VDVL+EQNI+P IKVDKGLVPLAGSNDESWCQGLDGLASR+AAYYQQGARFAKWRTVVSIP
Sbjct:    2 LTIRAGSYADELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEVNRQAWRTLLVTVPTLGEYISGAILFEETLYQSTTDGRKIVDVLIEQNIIPGIKVDKGLVPLAGSNDESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIP 151          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC_ORYSJ (Fructose-bisphosphate aldolase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0171300 PE=1 SV=2)

HSP 1 Score: 279.641 bits (714), Expect = 1.092e-74
Identity = 145/177 (81.92%), Postives = 153/177 (86.44%), Query Frame = 1
Query:  154 KSEW-VKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            KSEW    QA     V+V        S+ +RAG+Y DELVKTAKT+ASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQST DGKK+VD+L EQ IVP IKVDKGLVPLAGSN+ESWCQGLDGLASR AAYYQQGARFAKWRTVVSIP
Sbjct:   15 KSEWGATRQAAAPKPVTV--------SMVVRAGAYDDELVKTAKTIASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTVDGKKIVDILTEQKIVPGIKVDKGLVPLAGSNNESWCQGLDGLASREAAYYQQGARFAKWRTVVSIP 183          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 267.7 bits (683), Expect = 4.294e-71
Identity = 132/145 (91.03%), Postives = 140/145 (96.55%), Query Frame = 1
Query:  247 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            GSYADELVKTAKT+ASPGRGILAMDESNATCGKRL SIGLENTEANRQA+RTLLVT P LG+YISGAILFEETLYQST DG+K+VDVLVEQNI+P IKVDKGLVPLAGSN+ESWCQGLDGLASR+AAYYQQGARFAKWRTVVSIP
Sbjct:    1 GSYADELVKTAKTIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAWRTLLVTVPTLGEYISGAILFEETLYQSTVDGRKIVDVLVEQNIIPGIKVDKGLVPLAGSNNESWCQGLDGLASRSAAYYQQGARFAKWRTVVSIP 145          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC3_ARATH (Probable fructose-bisphosphate aldolase 3, chloroplastic OS=Arabidopsis thaliana GN=FBA3 PE=1 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.205e-67
Identity = 128/175 (73.14%), Postives = 146/175 (83.43%), Query Frame = 1
Query:  157 SEWVKGQAIRQSTVSVRSLPSGPSSLTIRAGSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            S W+  ++   ++ S  S P    S  IRAG+Y+DELVKTAK++ASPGRGILA+DESNATCGKRLASIGL+NTE NRQAYR LL+T PGLG YISG+ILFEETLYQST DGK  VD L + NIVP IKVDKGL PLAGSN+ESWCQGLDGLASR+A YY+QGARFAKWRTVVS+P
Sbjct:   14 SPWIGQRSFAHTSAS--SSPPPRVSFAIRAGAYSDELVKTAKSIASPGRGILAIDESNATCGKRLASIGLDNTEDNRQAYRQLLLTTPGLGDYISGSILFEETLYQSTKDGKTFVDCLRDANIVPGIKVDKGLSPLAGSNEESWCQGLDGLASRSAEYYKQGARFAKWRTVVSVP 186          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALFC_CHLRE (Fructose-bisphosphate aldolase 1, chloroplastic OS=Chlamydomonas reinhardtii GN=ALDCHL PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 4.314e-55
Identity = 112/145 (77.24%), Postives = 120/145 (82.76%), Query Frame = 1
Query:  247 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSIP 681
            G Y +EL+KTA TVAS GRGILAMDESNATCGKRL SIG+ENTE NR+AYR LLVTAPGLGQYISGAILFEETLYQST  GKK VDV+ EQNIVP IKVDKGLVP   +   SWC GLDG  S  A YY+ GARFAKWR+VVSIP
Sbjct:   28 GKYDEELIKTAGTVASKGRGILAMDESNATCGKRLDSIGVENTEENRRAYRELLVTAPGLGQYISGAILFEETLYQSTASGKKFVDVMKEQNIVPGIKVDKGLVP-CPTPTMSWCMGLDGWTS-AAEYYKAGARFAKWRSVVSIP 170          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 182.57 bits (462), Expect = 1.817e-45
Identity = 90/142 (63.38%), Postives = 106/142 (74.65%), Query Frame = 1
Query:  253 YADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 678
            Y DEL+KTAK +A+PGRGILA DES  T GKR A I +ENTE+NRQAYR LL T+PG    +SG ILFEETLYQ T+DGK  VD+L+E  ++P IKVDKGLV LAG+N E+  QGLD L +R   YY+ GARFAKWR    I
Sbjct:    8 YEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKI 149          
BLAST of FC869045 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 4.047e-45
Identity = 88/144 (61.11%), Postives = 109/144 (75.69%), Query Frame = 1
Query:  247 GSYADELVKTAKTVASPGRGILAMDESNATCGKRLASIGLENTEANRQAYRTLLVTAPGLGQYISGAILFEETLYQSTTDGKKMVDVLVEQNIVPSIKVDKGLVPLAGSNDESWCQGLDGLASRTAAYYQQGARFAKWRTVVSI 678
            G YADEL+K AK +A+PG+GILA DES  T GKRLASI +EN EANRQA R LL T+P   QY+SG ILFEETLYQ +++GK  V++L E N++P IKVDKG+V LAG++ E+  QG D L +R   YY+ GARFAKWR V+ I
Sbjct:    6 GKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKI 149          
The following BLAST results are available for this feature:
BLAST of FC869045 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALFC_SPIOL1.423e-8285.08Fructose-bisphosphate aldolase, chloroplastic OS=S... [more]
ALFC1_ARATH1.127e-7985.00Probable fructose-bisphosphate aldolase 1, chlorop... [more]
ALFC2_ARATH1.923e-7983.61Probable fructose-bisphosphate aldolase 2, chlorop... [more]
ALFC1_PEA6.401e-7592.00Fructose-bisphosphate aldolase 1, chloroplastic (F... [more]
ALFC_ORYSJ1.092e-7481.92Fructose-bisphosphate aldolase, chloroplastic OS=O... [more]
ALFC2_PEA4.294e-7191.03Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALFC3_ARATH2.205e-6773.14Probable fructose-bisphosphate aldolase 3, chlorop... [more]
ALFC_CHLRE4.314e-5577.24Fructose-bisphosphate aldolase 1, chloroplastic OS... [more]
ALF_ARATH1.817e-4563.38Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA4.047e-4561.11Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007H09EF AbioticL1 Citrus clementina cDNA clone C31007H09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869045 ID=FC869045|Name=FC869045|organism=Citrus clementina|type=EST|length=704bp
GGGTAAAGAGGCAGAAGAAAGACAGTGAAGATAAGATTATAAGTGCTATA
AGCTAAGGCCTCTCGAGCTCAGAACCCACAGCAAGAAGAAGCAAAGAGGA
AAATGGCCTCAGCCTCGGCATCTTTACTCAAGTCATCATCCCCCGTTCTT
GACAAGTCTGAGTGGGTTAAGGGCCAGGCCATCCGCCAGTCTACTGTCTC
AGTCCGCAGCCTCCCCAGTGGCCCCTCTTCCCTCACCATCCGTGCTGGTT
CCTATGCCGATGAGCTTGTCAAGACCGCGAAAACTGTTGCATCACCAGGA
CGTGGAATTTTGGCCATGGATGAGTCAAATGCAACTTGTGGAAAACGCCT
TGCCTCAATTGGGTTAGAGAACACTGAGGCTAACCGCCAGGCATACCGTA
CCCTCCTTGTTACAGCCCCTGGTCTTGGACAGTACATCTCTGGTGCCATC
CTTTTTGAGGAGACTCTCTACCAATCCACCACCGATGGCAAGAAGATGGT
CGATGTTCTTGTTGAGCAAAACATTGTCCCCAGTATCAAAGTCGACAAGG
GTTTGGTGCCCCTTGCTGGTTCCAATGATGAGTCATGGTGCCAGGGTCTT
GATGGCCTGGCTTCTCGCACTGCTGCTTACTACCAACAGGGAGCTCGTTT
CGCCAAATGGCGTACTGTTGTGAGCATTCCCATGGCCCATCTGCCTTGGC
AGTC
back to top