FC869046

Overview
NameFC869046
Unique NameFC869046
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT3_ARATH (Probable caffeoyl-CoA O-methyltransferase At4g26220 OS=Arabidopsis thaliana GN=At4g26220 PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.115e-74
Identity = 133/181 (73.48%), Postives = 160/181 (88.40%), Query Frame = 1
Query:  157 SKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            +KGLL+SE+LY+YILETSVYPREPE L+++R++T +HP A M TAPDAGQLM MLL LVNA+KTIE+GVFTGYSLLLTALT+PEDG++ AID+NR++YEIGLP+IKKAGV+HKI+F ESEAL  LD+LL    NEG FD+AFVDAD  NY NYHERL++L+KVGGI VYDNTLWGG+VA P
Sbjct:    6 AKGLLKSEELYKYILETSVYPREPEVLRELRNITHNHPQAGMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKVIAIDMNRDSYEIGLPVIKKAGVEHKIDFKESEALPALDELLNNKVNEGGFDFAFVDADKLNYWNYHERLIRLIKVGGIIVYDNTLWGGSVAEP 186          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT_MESCR (Caffeoyl-CoA O-methyltransferase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 255.758 bits (652), Expect = 1.674e-67
Identity = 118/185 (63.78%), Postives = 152/185 (82.16%), Query Frame = 1
Query:  145 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            Q    K LLQS+ L++YILETSVYPREPEP+K++RD+TA HPW +M T+ D GQ + MLL+L+NAK TIEIGV+TGYSLL +AL +P+DG+I A+D+NRE YE+GLP+I+KAGV HKI+F E  AL VLD L++ ++N GSFD+AFVDAD DNY NYH+RL+ L+K+GG+  YDNTLW G+VA P
Sbjct:   23 QEVGHKSLLQSDALFQYILETSVYPREPEPMKELRDITAKHPWNLMTTSADEGQFLNMLLKLINAKNTIEIGVYTGYSLLASALALPDDGKILAMDINRENYELGLPVIQKAGVAHKIDFREGPALPVLDLLIEDAKNHGSFDFAFVDADKDNYGNYHKRLIDLVKIGGVIGYDNTLWNGSVAAP 207          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT_MEDSA (Caffeoyl-CoA O-methyltransferase OS=Medicago sativa GN=CCOMT PE=1 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.085e-66
Identity = 117/185 (63.24%), Postives = 150/185 (81.08%), Query Frame = 1
Query:  145 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            Q    K LLQS+ LY+YILETSV+PRE E +K++R+VTA HPW +M T+ D GQ ++MLL+L+NAK T+EIGV+TGYSLL TAL IPEDG+I A+D+N+E YE+GLP+IKKAGVDHKI+F E  AL VLD+++K  +N GS+D+ FVDAD DNY NYH+RL+ L+KVGG+  YDNTLW G+V  P
Sbjct:   16 QEVGHKSLLQSDALYQYILETSVFPREHEAMKELREVTAKHPWNIMTTSADEGQFLSMLLKLINAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAP 200          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT4_ARATH (Probable caffeoyl-CoA O-methyltransferase At4g34050 OS=Arabidopsis thaliana GN=At4g34050 PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 2.418e-66
Identity = 117/185 (63.24%), Postives = 149/185 (80.54%), Query Frame = 1
Query:  145 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            Q    K LLQS+DLY+YILETSVYPREPE +K++R+VTA HPW +M T+ D GQ + ML++LVNAK T+EIGV+TGYSLL TAL +PEDG+I A+DVNRE YE+GLPII+KAGV HKI+F E  AL VLD+++   +N G++D+ FVDAD DNY NYH+RL+ L+K+GG+  YDNTLW G+V  P
Sbjct:   28 QEVGHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKIGGVIGYDNTLWNGSVVAP 212          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT1_MAIZE (Caffeoyl-CoA O-methyltransferase 1 OS=Zea mays GN=CCOAOMT1 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.158e-66
Identity = 116/180 (64.44%), Postives = 147/180 (81.67%), Query Frame = 1
Query:  160 KGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            K LL+S+DLY+YIL+TSVYPREPE +K++R+VTA HPW +M T+ D GQ + ML++L+ AKKT+EIGV+TGYSLL TAL +PEDG I A+D+NRE YE+GLP I+KAGV HKI+F E  AL VLD L+   +N GSFD+ FVDAD DNY NYHERL+KL+K+GG+  YDNTLW G+V +P
Sbjct:   32 KSLLKSDDLYQYILDTSVYPREPESMKELREVTAKHPWNLMTTSADEGQFLNMLIKLIGAKKTMEIGVYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDDLIAEEKNHGSFDFVFVDADKDNYLNYHERLLKLVKLGGLIGYDNTLWNGSVVLP 211          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT_POPTM (Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.124e-66
Identity = 119/185 (64.32%), Postives = 149/185 (80.54%), Query Frame = 1
Query:  145 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            Q    K LLQS+ LY+YILETSVYPREPE +K++R+VTA HPW +M T+ D GQ + MLL+LVNAK T+EIGV+TGYSLL TAL IPEDG+I A+D+NRE YE+GLP+I+KAGV HKI+F E  AL VLDQ+++  +  GSFD+ FVDAD DNY NYH+RL++L+KVGG+  YDNTLW G+V  P
Sbjct:   16 QEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAP 200          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT5_TOBAC (Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.124e-66
Identity = 118/185 (63.78%), Postives = 148/185 (80.00%), Query Frame = 1
Query:  145 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            Q    K LLQS+ LY+YILETSVYPREPE +K++R+VTA HPW +M T+ D GQ + MLL+L+NAK T+EIGV+TGYSLL TAL IP+DG+I A+D+NRE YEIGLPII+KAGV HKI F E  AL VLDQL++  +N G++D+ FVDAD DNY NYH+R++ L+KVGG+  YDNTLW G+V  P
Sbjct:    9 QEVGHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEKAGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYDNTLWNGSVVAP 193          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT1_TOBAC (Caffeoyl-CoA O-methyltransferase 1 OS=Nicotiana tabacum GN=CCOAOMT1 PE=1 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 4.124e-66
Identity = 114/190 (60.00%), Postives = 151/190 (79.47%), Query Frame = 1
Query:  130 TDKAKQAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            T+   Q    K LLQS+ LY+YILETSVYPREPEP+K++R++TA HPW +M T+ D GQ ++ML++L+NAK T+EIGVFTGYSLL TA+ +P+DG+I A+D+NRE YEIGLP+I+KAG+ HKI F E  AL VLDQ+++  +  GS+D+ FVDAD DNY NYH+RL+ L+K+GG+  YDNTLW G+V  P
Sbjct:    3 TNGRHQEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEGQFLSMLIKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIEFKEGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKIGGLIGYDNTLWNGSVVAP 192          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT2_TOBAC (Caffeoyl-CoA O-methyltransferase 2 OS=Nicotiana tabacum GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.387e-66
Identity = 116/185 (62.70%), Postives = 149/185 (80.54%), Query Frame = 1
Query:  145 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            Q    K LLQS+ LY+YILETSVYPREPEP+K++R++TA HPW +M T+ D GQ ++MLL+L+NAK T+EIGVFTGYSLL TA+ +P+DG+I A+D+NRE YEIGLPII+KAG+ HKI F E  AL VLDQ+++  +  GS+D+ FVDAD DNY NYH+RL+ L+KVGG+  YDNTLW G+V  P
Sbjct:   11 QEVGHKSLLQSDALYQYILETSVYPREPEPMKELREITAKHPWNLMTTSADEGQFLSMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPIIEKAGLAHKIVFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAP 195          
BLAST of FC869046 vs. ExPASy Swiss-Prot
Match: CAMT1_POPTR (Caffeoyl-CoA O-methyltransferase 1 OS=Populus trichocarpa GN=CCOAOMT1 PE=2 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 5.387e-66
Identity = 119/185 (64.32%), Postives = 149/185 (80.54%), Query Frame = 1
Query:  145 QAASSKGLLQSEDLYRYILETSVYPREPEPLKKIRDVTADHPWAMMGTAPDAGQLMAMLLRLVNAKKTIEIGVFTGYSLLLTALTIPEDGQITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADXDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVP 699
            Q    K LLQS+ LY+YILETSVYPREPE +K++R+VTA HPW +M T+ D GQ + MLL+LVNAK T+EIGV+TGYSLL TAL IPEDG+I A+D+NRE YE+GLP+I+KAGV HKI+F E  AL VLDQ+++  +  GSFD+ FVDAD DNY NYH+RL++L+KVGG+  YDNTLW G+V  P
Sbjct:   16 QEVGHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAP 200          
The following BLAST results are available for this feature:
BLAST of FC869046 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
CAMT3_ARATH4.115e-7473.48Probable caffeoyl-CoA O-methyltransferase At4g2622... [more]
CAMT_MESCR1.674e-6763.78Caffeoyl-CoA O-methyltransferase OS=Mesembryanthem... [more]
CAMT_MEDSA1.085e-6663.24Caffeoyl-CoA O-methyltransferase OS=Medicago sativ... [more]
CAMT4_ARATH2.418e-6663.24Probable caffeoyl-CoA O-methyltransferase At4g3405... [more]
CAMT1_MAIZE3.158e-6664.44Caffeoyl-CoA O-methyltransferase 1 OS=Zea mays GN=... [more]
CAMT_POPTM4.124e-6664.32Caffeoyl-CoA O-methyltransferase OS=Populus tremul... [more]
CAMT5_TOBAC4.124e-6663.78Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana ta... [more]
CAMT1_TOBAC4.124e-6660.00Caffeoyl-CoA O-methyltransferase 1 OS=Nicotiana ta... [more]
CAMT2_TOBAC5.387e-6662.70Caffeoyl-CoA O-methyltransferase 2 OS=Nicotiana ta... [more]
CAMT1_POPTR5.387e-6664.32Caffeoyl-CoA O-methyltransferase 1 OS=Populus tric... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31007H10EF AbioticL1 Citrus clementina cDNA clone C31007H10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869046 ID=FC869046|Name=FC869046|organism=Citrus clementina|type=EST|length=700bp
GGATGTAATATTAAGCAAAAGTCAACCGCAAGTGAAAGAGAGGCCAATTG
GATAAGATTCGCCGGATTGCTGTCCTCACGTCACTGGATCTGGTCAAAAT
ATCTTATGTGAAGCAGGTGGAGAGCAATGACAGACAAAGCAAAACAAGCA
GCAAGTAGCAAGGGATTGTTGCAAAGTGAAGATTTATACAGGTATATCCT
TGAGACGAGTGTTTACCCAAGAGAGCCAGAGCCGCTGAAGAAGATAAGAG
ATGTTACTGCTGACCATCCATGGGCCATGATGGGCACTGCACCGGATGCA
GGTCAGTTAATGGCCATGCTCTTGAGGCTAGTGAATGCCAAGAAAACTAT
TGAAATTGGAGTTTTCACTGGATATTCTCTTCTCCTCACTGCACTCACAA
TTCCAGAGGATGGTCAGATTACAGCAATTGATGTGAATCGTGAAACATAT
GAAATAGGATTACCTATCATTAAAAAGGCTGGAGTTGATCACAAGATAAA
CTTCATTGAATCCGAGGCACTATCAGTTCTTGATCAGCTACTAAAATATA
GTGAAAATGAAGGCAGTTTTGACTATGCTTTTGTGGATGCCGACNAGGAC
AACTACTGTAACTACCATGAGAGGTTGATGAAGTTGTTGAAGGTGGGCGG
TATAGCTGTCTATGACAACACACTCTGGGGGGGAACAGTTGCAGTGCCTG
back to top