FC869061

Overview
NameFC869061
Unique NameFC869061
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length695
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14314 contig Ccv1_Contig14314:46..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869061 vs. ExPASy Swiss-Prot
Match: YAI5_SCHPO (Uncharacterized protein C24B11.05 OS=Schizosaccharomyces pombe GN=SPAC24B11.05 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.582e-12
Identity = 49/129 (37.98%), Postives = 65/129 (50.39%), Query Frame = 3
Query:  132 LLFDLDDTLYPYSSGIAAACGQNIKDYMVEKLGIERSKIEDLGNLLYKNYGTTMAGLRAIGYDFDYDDYHSFVHGRLPYEN-LKPDPVXXXXXXXXXXXK--IIFTNADKVHAVKVLSRLGLEDCFEGI 509
            + FDLD+ LYP S  I       I  +  +KLGI   + E L  + Y++YG  + GL  + ++ D  DY   V   LP E  +K D V               IFTNA  VHA +VL  LG+EDCF+GI
Sbjct:    8 IFFDLDNCLYPKSYKIHNMMAARITAFFSDKLGIPTEEAERLREVYYRHYGIAIRGL-VLHHEIDAVDYDQRVDQSLPLEKVIKKDEVLREMLLELRKKYKCWIFTNAYIVHANRVLKYLGIEDCFDGI 135          
The following BLAST results are available for this feature:
BLAST of FC869061 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
YAI5_SCHPO2.582e-1237.98Uncharacterized protein C24B11.05 OS=Schizosacchar... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31008B01EF AbioticL1 Citrus clementina cDNA clone C31008B01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869061 ID=FC869061|Name=FC869061|organism=Citrus clementina|type=EST|length=695bp
ATGTTGATTTGGTTCGTTTCAAGTTTAGTTGGAGCGTTGAACTAACATGT
TTTGATCACTTGCTGAAGGTCTTTTCAATCAAAATGGAGTACGAAGGCCG
TTACCGGATGGCTGCTGCGAAATATGATTGCCTTCTGTTTGATCTAGATG
ATACCCTGTATCCCTACAGTTCTGGTATTGCTGCAGCATGCGGACAGAAC
ATCAAAGATTATATGGTTGAAAAGCTTGGCATTGAGAGGAGCAAAATTGA
GGACTTGGGTAACTTGTTGTACAAGAATTACGGGACAACAATGGCTGGGC
TCAGGGCTATTGGCTATGACTTTGACTATGATGACTATCACAGTTTTGTG
CATGGGAGGTTGCCTTATGAGAACTTGAAACCAGATCCTGTTTTGAGGAG
TCTTTTGCTGAGCCTGCCCCTAAGGAAAATTATCTTCACAAATGCGGACA
AAGTTCATGCTGTTAAAGTTCTCAGCAGGCTCGGATTGGAAGACTGTTTT
GAAGGGATTATATGCTTTGAGACTCTGAATCCGACTCACAAGAACAATGT
TTCTGATGATGAGGATGACATTGCGTTTGTGGAATCGGCTGCTTCCACCA
CAACTAGCGCCAATGGCCCTGAAATTTTCGACATAATTGGTCATTTTGCT
CAACCAATCCAAGCTTGGTTGCATTGCCAAGACTCCCATTGTGTG
back to top