FC869188

Overview
NameFC869188
Unique NameFC869188
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CYSP_SCHJA (Cathepsin B-like cysteine proteinase OS=Schistosoma japonicum GN=CATB PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.334e-23
Identity = 64/192 (33.33%), Postives = 98/192 (51.04%), Query Frame = 3
Query:  141 VISSQTFAEG-VVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLG--VPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVN-XXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEP 704
            ++S  TF E  V ++       L D +I  +NE+P AGWKA ++ +F  +++   + L+G +     +       V  HD ++++P  FD+R  WP C +IS+I DQ  CGSCWAFGAVEA++DR CI  G   S  ++                  +P  AW Y+V  G+VT         +  +H GC+P
Sbjct:    8 IVSLFTFLEAHVTTRNNQRIEPLSDEMISFINEHPDAGWKADKSDRF--HSLDDARILMGARKEDAEMKRNRRPTVDHHDLNVEIPSQFDSRKKWPHCKSISQIRDQSRCGSCWAFGAVEAMTDRICIQSGGGQSAELSALDLISCCKDCGDGCQGGFPGVAWDYWVKRGIVT-------GGSKENHTGCQP 190          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CATB_MACFA (Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.334e-23
Identity = 74/200 (37.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query:  123 CLLILGVISSQTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTH----DKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVN--XXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEP 704
            CLL LG   S+              H L D ++  VN+     W+A  N  F N  V   K L G         LG P         + LKLP+SFDAR  WPQC TI  I DQG CGSCWAFGAVEA+SDR CIH   ++S+ V+                   YP  AW ++   G+V+      +D    SH GC P
Sbjct:   10 CLLALGDARSRP-----------SFHPLSDELVNYVNKQ-NTTWQAGHN--FYNVDVSYLKRLCGT-------FLGGPKPPQRVMFTEDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGIMCGDGCNGGYPAGAWNFWTRKGLVS---GGLYD----SHVGCRP 181          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CATB_PONAB (Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 9.699e-23
Identity = 69/177 (38.98%), Postives = 84/177 (47.46%), Query Frame = 3
Query:  198 HILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTH----DKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVN--XXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGC---SHPGCE 701
            H L D ++  VN+     W+A  N  F N  V   K L G         LG P         + LKLP+SFDAR  WPQC TI  I DQG CGSCWAFGAVEA+SDR CIH   ++S+ V+                   YP  AW ++   G+V+     Y    GC   S P CE
Sbjct:   24 HPLSDELVNYVNKR-NTTWQAGHN--FYNVDVSYLKKLCGT-------FLGGPKPPQRVMFTEDLKLPESFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGL--YESHVGCRPYSIPPCE 188          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CATB_HUMAN (Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3)

HSP 1 Score: 105.531 bits (262), Expect = 2.822e-22
Identity = 68/177 (38.42%), Postives = 83/177 (46.89%), Query Frame = 3
Query:  198 HILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTH----DKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVN--XXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGC---SHPGCE 701
            H L D ++  VN+     W+A  N  F N  +   K L G         LG P         + LKLP SFDAR  WPQC TI  I DQG CGSCWAFGAVEA+SDR CIH   ++S+ V+                   YP  AW ++   G+V+     Y    GC   S P CE
Sbjct:   24 HPLSDELVNYVNKR-NTTWQAGHN--FYNVDMSYLKRLCGT-------FLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGL--YESHVGCRPYSIPPCE 188          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CYSP_SCHMA (Cathepsin B-like cysteine proteinase OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.814e-22
Identity = 69/196 (35.20%), Postives = 100/196 (51.02%), Query Frame = 3
Query:  132 ILGVISSQTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLG--VPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFG--MNLSLS-VNXXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEP 704
            IL + S  TF E  +S        L D II  +NE+P AGW+A ++ +F  +++   +  +G +     L       V  +D ++++P +FD+R  WP C +I+ I DQ  CGSCW+FGAVEA+SDR CI  G   N+ LS V+                  P  AW Y+V  G+VT        S+  +H GCEP
Sbjct:    5 ILCIASLITFLEAHISVKNEKFEPLSDDIISYINEHPNAGWRAEKSNRF--HSLDDARIQMGARREEPDLRRKRRPTVDHNDWNVEIPSNFDSRKKWPGCKSIATIRDQSRCGSCWSFGAVEAMSDRSCIQSGGKQNVELSAVDLLTCCESCGLGCEGGILGP--AWDYWVKEGIVTA-------SSKENHTGCEP 189          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CATB_RAT (Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 1.829e-21
Identity = 65/179 (36.31%), Postives = 84/179 (46.93%), Query Frame = 3
Query:  186 KLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTH----DKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFG--MNLSLSVNXXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEP 704
            K  SH L D +I  +N+     W+A RN  F N  +   K L G        +LG P         + + LP+SFDAR  W  C TI++I DQG CGSCWAFGAVEA+SDR CIH    +N+ +S                   YP  AW ++   G+V+            SH GC P
Sbjct:   20 KPSSHPLSDDMINYINKQ-NTTWQAGRN--FYNVDISYLKKLCGT-------VLGGPNLPERVGFSEDINLPESFDAREQWSNCPTIAQIRDQGSCGSCWAFGAVEAMSDRICIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWNFWTRKGLVS-------GGVYNSHIGCLP 181          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CPR6_CAEEL (Cathepsin B-like cysteine proteinase 6 OS=Caenorhabditis elegans GN=cpr-6 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 6.951e-21
Identity = 73/221 (33.03%), Postives = 103/221 (46.61%), Query Frame = 3
Query:  108 LFLTTCLLILGVISSQTFAEGVVSKLK---LDSHILQ---DSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVP------------VKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCI--HFGMNLSLSVNXXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCS---HPGCE 701
            L   +C+++    +     E V+ K +   +DS   +   D +I  VNEN    W A +  +FS+        + G     K  L+GV              KT D  L +P+SFD+R  WP+C +I  I DQ  CGSCWAFGAVEA+SDR CI  H  + ++LS +                  P++AWRY+V  G+VT     Y  + GC     P CE
Sbjct:    4 LLFLSCIVVAAYCACNDNLESVLDKYRNREIDSEAAELDGDDLIDYVNENQNL-WTAKKQRRFSS--------VYGENDKAKWGLMGVNHVRLSVKGKQHLSKTKDLDLDIPESFDSRDNWPKCDSIKVIRDQSSCGSCWAFGAVEAMSDRICIASHGELQVTLSADDLLSCCKSCGFGCNGGD-PLAAWRYWVKDGIVTG--SNYTANNGCKPYPFPPCE 212          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CTSB_DICDI (Cathepsin B OS=Dictyostelium discoideum GN=ctsB PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.450e-20
Identity = 58/152 (38.16%), Postives = 79/152 (51.97%), Query Frame = 3
Query:  252 WKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTHDK-SLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNXXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEP 704
            W   +  QF N  VGQ   LLG K +P    L   +K++D   +++P SF+A++ WP C+TIS+I +Q  CGSCWAFGA E+ +DR CIH   N+ LS                   +  SAW +    G V+EEC PY      + P C P
Sbjct:   39 WVEEQTDQFDNIKVGQ---LLGFKRSPNRPKL--QIKSYDPLGVQIPTSFNAQTNWPNCTTISQIQNQARCGSCWAFGATESATDRLCIHNNENVQLSFMDMVTCDETDNGCEGGDAF--SAWNWLRKQGAVSEECLPY------TIPTCPP 177          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CATB_MOUSE (Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 4.506e-20
Identity = 71/205 (34.63%), Postives = 91/205 (44.39%), Query Frame = 3
Query:  108 LFLTTCLLILGVISSQTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVK----THDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFG--MNLSLSVNXXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEP 704
            L L +CLL L      T A       K   H L D +I  +N+     W+A RN  F N  +   K L G        +LG P         + + LP++FDAR  W  C TI +I DQG CGSCWAFGAVEA+SDR CIH    +N+ +S                   YP  AW ++   G+V+            SH GC P
Sbjct:    5 LILLSCLLAL------TSAHD-----KPSFHPLSDDLINYINKQ-NTTWQAGRN--FYNVDISYLKKLCGT-------VLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVS-------GGVYNSHVGCLP 181          
BLAST of FC869188 vs. ExPASy Swiss-Prot
Match: CATB_BOVIN (Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5)

HSP 1 Score: 97.8265 bits (242), Expect = 5.884e-20
Identity = 64/174 (36.78%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  204 LQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTHDK---SLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFG--MNLSLSVNXXXXXXXXXXXXXXXXXYPISAWRYFVHHGVVTEECDPYFDSTGC---SHPGCE 701
            L D ++  VN+     WKA  N  F N  +   K L G       +L G  +   D     + LP+SFDAR  WP C TI  I DQG CGSCWAFGAVEA+SDR CIH    +N+ +S                   +P  AW ++   G+V+     Y    GC   S P CE
Sbjct:   26 LSDELVNFVNKQ-NTTWKAGHN--FYNVDLSYVKKLCGA------ILGGPKLPQRDAFAADVVLPESFDAREQWPNCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHSNGRVNVEVSAEDMLTCCGGECGDGCNGGFPSGAWNFWTKKGLVSGGL--YNSHVGCRPYSIPPCE 188          
The following BLAST results are available for this feature:
BLAST of FC869188 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
CYSP_SCHJA3.334e-2333.33Cathepsin B-like cysteine proteinase OS=Schistosom... [more]
CATB_MACFA3.334e-2337.00Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV... [more]
CATB_PONAB9.699e-2338.98Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1[more]
CATB_HUMAN2.822e-2238.42Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3[more]
CYSP_SCHMA4.814e-2235.20Cathepsin B-like cysteine proteinase OS=Schistosom... [more]
CATB_RAT1.829e-2136.31Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2[more]
CPR6_CAEEL6.951e-2133.03Cathepsin B-like cysteine proteinase 6 OS=Caenorha... [more]
CTSB_DICDI3.450e-2038.16Cathepsin B OS=Dictyostelium discoideum GN=ctsB PE... [more]
CATB_MOUSE4.506e-2034.63Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2[more]
CATB_BOVIN5.884e-2036.78Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31009E02EF AbioticL1 Citrus clementina cDNA clone C31009E02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869188 ID=FC869188; Name=FC869188; organism=Citrus clementina; type=EST; length=705bp
GGAGAAGAAGGGGCCCGGGGGTCTTGGCTCCAACACAAGAAAAGTGCTCT
CTCCCATTTCTCCTCTCTTCGTCCTTCCCGAGCCAGTCATCCATGGCTCC
ATCTCACCTCTTTCTTACTACATGTTTGTTAATTCTTGGCGTTATCTCCT
CCCAGACTTTTGCAGAGGGAGTGGTTTCCAAGCTCAAGCTTGATTCTCAT
ATTCTCCAGGATTCAATCATCAAAGAAGTGAATGAGAACCCTAAGGCTGG
ATGGAAAGCTGCCAGAAATCCTCAATTTTCCAATTACACTGTTGGGCAAT
TTAAGCACCTTCTTGGAGTCAAGCCAACACCTAAAGGGCTGCTCTTGGGT
GTCCCTGTTAAAACTCATGACAAATCCTTGAAGTTGCCTAAAAGCTTTGA
TGCAAGGTCCGCTTGGCCACAATGCAGCACCATTAGTAGGATCCTAGATC
AGGGCCATTGTGGTTCTTGTTGGGCTTTTGGTGCTGTTGAAGCGCTATCT
GATCGTTTCTGCATCCATTTTGGCATGAACCTATCTCTATCAGTTAATGA
TCTTTTAGCCTGCTGTGGCTTTTTGTGTGGAGATGGTTGTGACGGGGGTT
ATCCAATTTCTGCATGGCGATACTTTGTCCACCATGGTGTTGTTACCGAA
GAGTGTGATCCCTACTTTGATAGTACTGGCTGTTCCCACCCTGGTTGTGA
GCCGG
back to top