FC869190

Overview
NameFC869190
Unique NameFC869190
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length512
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869190 vs. ExPASy Swiss-Prot
Match: TOCC_ARATH (Tocopherol cyclase, chloroplastic OS=Arabidopsis thaliana GN=VTE1 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.701e-39
Identity = 81/131 (61.83%), Postives = 97/131 (74.05%), Query Frame = 1
Query:  127 RTVEHLDSTLRPLLYTKR--RHFNRVLVLASSAQT-VGGVSVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFKKKLSSLEVAQHGPRFTGVGVQILGADDKYMC 510
            R V  L  +L P   TK   R  +RV    S+  +    +SV PVY PT  NRELRTPHSGYHFDG+ R+FFEGWYFRVSIPE+++SFC +YSVENPAF++ LS LEVA +GPRFTGVG QILGA+DKY+C
Sbjct:   21 RPVSPLTRSLVPFRSTKLVPRSISRVSASISTPNSETDKISVKPVYVPTSPNRELRTPHSGYHFDGTPRKFFEGWYFRVSIPEKRESFCFMYSVENPAFRQSLSPLEVALYGPRFTGVGAQILGANDKYLC 151          
BLAST of FC869190 vs. ExPASy Swiss-Prot
Match: TOCC_MAIZE (Probable tocopherol cyclase, chloroplastic OS=Zea mays GN=SDX1 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 2.152e-34
Identity = 67/118 (56.78%), Postives = 86/118 (72.88%), Query Frame = 1
Query:  172 TKRRHFNRVLVLASSAQTVGG-----VSVNPVYKPTPRNRELRTPHSGYHFDGSTRRFFEGWYFRVSIPERKQSFCIIYSVENPAFKKKLSSLEVAQHGPRFTGVGVQILGADDKYMC 510
            + RRH  R +V  +++ +V        +  P+Y PTP++R LRTPHSGYHFDG+ R FFEGWYF+VSIPE +QSFC +YSVENP F+  +S L+   + PRFTGVG QILGADDKY+C
Sbjct:   23 SSRRHCPRGVVPRAASSSVSSFTSPSAAAAPIYTPTPQDRSLRTPHSGYHFDGTARPFFEGWYFKVSIPECRQSFCFMYSVENPLFRDGMSDLDKLLYRPRFTGVGAQILGADDKYIC 140          
The following BLAST results are available for this feature:
BLAST of FC869190 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
TOCC_ARATH1.701e-3961.83Tocopherol cyclase, chloroplastic OS=Arabidopsis t... [more]
TOCC_MAIZE2.152e-3456.78Probable tocopherol cyclase, chloroplastic OS=Zea ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31009E04EF AbioticL1 Citrus clementina cDNA clone C31009E04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869190 ID=FC869190; Name=FC869190; organism=Citrus clementina; type=EST; length=512bp
ACCTAATTACTGGTTAAAGAAATAAACACATACGCACTAGCAGCAGCGTA
CCCGCGGTTTTTTCACTTCCCATTTCTCTGTTTTCAGATGGAATCAAATC
TTTGCTTCTCACAAAACTTAGGGTTCCGAACTGTAGAGCACCTCGACTCT
ACTCTTAGACCCTTGCTTTATACAAAACGCCGTCATTTCAACAGAGTGTT
GGTGTTGGCTTCTTCAGCTCAAACTGTGGGCGGAGTCTCCGTCAATCCTG
TTTATAAGCCAACGCCACGCAATCGAGAGCTTCGAACTCCTCACAGCGGG
TACCATTTTGATGGGAGTACTCGTAGGTTTTTTGAGGGTTGGTATTTTAG
GGTCTCAATTCCAGAGCGAAAGCAAAGCTTTTGCATTATTTATTCGGTGG
AGAATCCTGCATTTAAGAAAAAATTATCGTCATTGGAAGTTGCACAGCAT
GGACCTAGATTTACAGGAGTTGGGGTTCAAATTCTTGGCGCCGATGACAA
GTATATGTGCCA
back to top