FC869192

Overview
NameFC869192
Unique NameFC869192
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length693
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869192 vs. ExPASy Swiss-Prot
Match: MYBG_DICDI (Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.080e-26
Identity = 56/65 (86.15%), Postives = 59/65 (90.77%), Query Frame = 1
Query:  250 KVRKPYTITKSRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNGT 444
            K RKPYTI+K RE+WTDEEH KFLEAL LFDRDWKKIE FVGSKTVIQIRSHAQKYF+KVQKN T
Sbjct:   30 KSRKPYTISKQRENWTDEEHQKFLEALTLFDRDWKKIESFVGSKTVIQIRSHAQKYFIKVQKNNT 94          
BLAST of FC869192 vs. ExPASy Swiss-Prot
Match: LHY_ARATH (Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 2.181e-19
Identity = 39/66 (59.09%), Postives = 55/66 (83.33%), Query Frame = 1
Query:  250 KVRKPYTITKSRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNGTI 447
            K RKPYTITK RE WT++EH++FLEAL+L+ R W++IE+ +G+KT +QIRSHAQK+F K++K   +
Sbjct:   13 KARKPYTITKQRERWTEDEHERFLEALRLYGRAWQRIEEHIGTKTAVQIRSHAQKFFTKLEKEAEV 78          
BLAST of FC869192 vs. ExPASy Swiss-Prot
Match: CCA1_ARATH (Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.720e-19
Identity = 41/62 (66.13%), Postives = 53/62 (85.48%), Query Frame = 1
Query:  250 KVRKPYTITKSRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQK 435
            K RKPYTITK RE WT+EEH++F+EAL+L+ R W+KIE+ V +KT +QIRSHAQK+F KV+K
Sbjct:   13 KTRKPYTITKQRERWTEEEHNRFIEALRLYGRAWQKIEEHVATKTAVQIRSHAQKFFSKVEK 74          
BLAST of FC869192 vs. ExPASy Swiss-Prot
Match: MYBH_DICDI (Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.186e-11
Identity = 30/54 (55.56%), Postives = 44/54 (81.48%), Query Frame = 1
Query:  280 SRESWTDEEHDKFLEALQLFDRDWKKIEDFVGSKTVIQIRSHAQKYFLKVQKNG 441
            +R SWT EE   F+EA +L+D+D KKI++ V +KT++Q+RSHAQK+ LK++KNG
Sbjct:  149 TRSSWTKEEERLFVEAYKLYDKDNKKIQEHVKTKTILQVRSHAQKFALKLEKNG 202          
The following BLAST results are available for this feature:
BLAST of FC869192 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
MYBG_DICDI1.080e-2686.15Myb-like protein G OS=Dictyostelium discoideum GN=... [more]
LHY_ARATH2.181e-1959.09Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV... [more]
CCA1_ARATH3.720e-1966.13Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 ... [more]
MYBH_DICDI2.186e-1155.56Myb-like protein H OS=Dictyostelium discoideum GN=... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31009E06EF AbioticL1 Citrus clementina cDNA clone C31009E06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869192 ID=FC869192; Name=FC869192; organism=Citrus clementina; type=EST; length=693bp
AACATCATTCTCCTCTCTCTCCCTCTCTCCCTCTCTCACAACTCTCAAGT
CTTGAACGTGTAGTCTTGCTTTCTCTACAAGTCTATGGCTTGAAGATTAA
AAGTGAAAATAAAAAATAAAAAAATTATGAACTCAAACACGTCATCATCA
ACGCACCATACGCCTCCCCAACCGATGGCCACCACTTCATCAGCTGCGAC
AACTTCATCATCGGCCATTGATGGAGGAGCAGGCGCAGCTGGGAGCAAGA
AGGTACGGAAACCCTACACCATCACCAAATCTAGAGAAAGCTGGACTGAC
GAAGAACACGACAAGTTCCTTGAAGCTCTTCAGCTGTTTGACCGTGACTG
GAAAAAAATTGAAGATTTTGTCGGTTCAAAGACAGTCATTCAGATTCGGA
GTCATGCTCAGAAATACTTTTTGAAGGTTCAAAAGAATGGGACAATTGCA
CATGTTCCTCCTCCTCGTCCCAAGCGGAAAGCTGCTCATCCTTACCCACA
AAAGGCCTCGAAAAATGTTCTACCGCCCCTTCAAGCAGCCATGGCTTATC
CATCAGTAAATGCCCTTGCACATGGATTTGCTGCTTGGGATGATGCTTCC
ATGCTGGTAAATGCTNGAAAAATGATGCCATCGCAGGATAAATATACCAA
TCTTCACGCAATCGAAGCTGATGATATTGGATCAAGGGGATAT
back to top