FC869197

Overview
NameFC869197
Unique NameFC869197
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length677
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.224e-104
Identity = 183/205 (89.27%), Postives = 193/205 (94.15%), Query Frame = 1
Query:   49 VATSTMALSSS-FVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +ATSTMALSSS F GKAV L+PS +E+   GR++MRKTA+K+   SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDP
Sbjct:    1 MATSTMALSSSTFAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDP 205          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 6.075e-104
Identity = 181/205 (88.29%), Postives = 193/205 (94.15%), Query Frame = 1
Query:   49 VATSTMALSS-SFVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A STMALSS SF GKAV L+PS +E+   G+++MRKTASK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DP
Sbjct:    1 MAASTMALSSPSFAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDP 205          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 6.075e-104
Identity = 179/204 (87.75%), Postives = 191/204 (93.63%), Query Frame = 1
Query:   49 VATSTMALSSSFVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A ST ALSS F GKAV L+PS +E+   G+++MRKTASK+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DP
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDP 204          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 8.772e-103
Identity = 176/203 (86.70%), Postives = 189/203 (93.10%), Query Frame = 1
Query:   49 VATSTMALSS-SFVGKAVNLAPSGNELGNGGRISMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A +TMALSS SF G+AV L+PS  E+   GR+SMRKT +K V+S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DP
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDP 203          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 1.146e-102
Identity = 177/203 (87.19%), Postives = 188/203 (92.61%), Query Frame = 1
Query:   49 VATSTMALSS-SFVGKAVNLAPSGNELGNGGRISMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A +TMALSS SF G+AV L+PS +E+   GRI+MRK  +KS  S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLA+DP
Sbjct:    1 MAAATMALSSPSFAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDP 203          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 1.146e-102
Identity = 177/204 (86.76%), Postives = 190/204 (93.14%), Query Frame = 1
Query:   49 VATSTMALSSSFVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A ST ALSS F GKAV L+PS +E+   G+++MRKTA+K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AG PLGEV DPLYPGGSFDPLGLA+DP
Sbjct:    1 MAASTTALSSPFAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGEPLGEVVDPLYPGGSFDPLGLAEDP 204          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.954e-102
Identity = 177/205 (86.34%), Postives = 192/205 (93.66%), Query Frame = 1
Query:   49 VATSTMALSSS-FVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A +TMALSSS F GKAV L+PS +E+   G+++MRKT +K+  +SSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLA+DP
Sbjct:    1 MAAATMALSSSSFAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDP 205          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB27_TOBAC (Chlorophyll a-b binding protein 7, chloroplastic OS=Nicotiana tabacum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 370.933 bits (951), Expect = 3.333e-102
Identity = 178/205 (86.83%), Postives = 189/205 (92.20%), Query Frame = 1
Query:   49 VATSTMALSS-SFVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +  STMALSS SF G AV L+PS +E+   G+  MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGA+EGYR+AGGPLGEVTDPLYPGGSFDPLGLADDP
Sbjct:    1 MTASTMALSSPSFAGNAVKLSPSSSEITGNGKAIMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDP 205          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB2A_SPIOL (Chlorophyll a-b binding protein, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 9.699e-102
Identity = 179/205 (87.32%), Postives = 189/205 (92.20%), Query Frame = 1
Query:   49 VATSTMALSS-SFVGKAVNLAPSGNELGNGGRISMRKTASK--SVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A+STMALSS S  GKAV L P+ +E+   GRI+MRKTA K  +V S SPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LMGAVEGYRIAGGPLGEV DPLYPGGSFDPLGLADDP
Sbjct:    1 MASSTMALSSPSLAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDP 205          
BLAST of FC869197 vs. ExPASy Swiss-Prot
Match: CB25_PETSP (Chlorophyll a-b binding protein 91R, chloroplastic OS=Petunia sp. GN=CAB91R PE=3 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 2.161e-101
Identity = 177/205 (86.34%), Postives = 189/205 (92.20%), Query Frame = 1
Query:   49 VATSTMALSS-SFVGKAVNLAPSGNELGNGGRISMRKTASKS--VSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDP 654
            +A +TMALSS SF GKAV  +PS +E+   G+ +MRKT +K+  VSSGSPWYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLMGAVEGYR+AGGPLGEV DPLYPGGSFDPLGLADDP
Sbjct:    1 MAAATMALSSPSFAGKAVKFSPSSSEITGNGKATMRKTVTKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDP 205          
The following BLAST results are available for this feature:
BLAST of FC869197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
CB2G_SOLLC1.224e-10489.27Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB24_TOBAC6.075e-10488.29Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC6.075e-10487.75Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB22_TOBAC8.772e-10386.70Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB2B_SOLLC1.146e-10287.19Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB25_NICPL1.146e-10286.76Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB25_TOBAC1.954e-10286.34Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB27_TOBAC3.333e-10286.83Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB2A_SPIOL9.699e-10287.32Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB25_PETSP2.161e-10186.34Chlorophyll a-b binding protein 91R, chloroplastic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31009E11EF AbioticL1 Citrus clementina cDNA clone C31009E11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869197 ID=FC869197; Name=FC869197; organism=Citrus clementina; type=EST; length=677bp
AGCAGCTGCTCTTTCCTGCCAACTTCTGCTTCTGAATTAAATTCCGCAGT
GGCCACCTCAACAATGGCTCTCTCCTCATCATTCGTCGGCAAGGCTGTGA
ACCTTGCCCCTTCAGGCAATGAGCTGGGCAATGGTGGCCGCATCTCCATG
CGTAAAACCGCGAGCAAGTCTGTTTCTTCAGGTAGCCCGTGGTACGGCCC
GGACAGAGTCAAGTACTTGGGCCCATTCTCTGGCGAGCCCCCAAGCTACT
TGACCGGTGAGTTCCCTGGCGACTACGGTTGGGACACAGCCGGGCTTTCA
GCTGACCCAGAAACCTTTGCCAAGAACCGCGAACTCGAAGTCATCCACTG
CAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCCGGAGCTCTTGG
CCCGCAACGGAGTCAAGTTCGGTGAGGCCGTGTGGTTCAAGGCAGGAGCT
CAGATCTTCAGCGAGGGCGGGCTTGACTACTTGGGAAACCCAAGCTTGAT
CCACGCCCAGAGCATCTTGGCCATCTGGGCTTGCCAGGTGGTATTGATGG
GAGCCGTTGAGGGTTACAGAATTGCTGGAGGGCCGCTCGGTGAAGTGACT
GACCCATTGTACCCAGGTGGCAGCTTTGATCCATTGGGTTTGGCTGATGA
CCCGAGGCTTTTGCTGAGCTCAGGTTA
back to top