FC869203

Overview
NameFC869203
Unique NameFC869203
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length652
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_SOLTU (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum tuberosum GN=PSBO PE=2 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 9.065e-94
Identity = 174/211 (82.46%), Postives = 184/211 (87.20%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QAAATLMQPTKVG V AR             KAFG++ + +R+SCSL  DLKD AQKC DA KIAGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVTVQL GGERVPFLFTI
Sbjct:    6 QAAATLMQPTKVGGVSARNNLQLRSSQSVS-KAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTI 215          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_TOBAC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Nicotiana tabacum GN=PSBO PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 1.184e-93
Identity = 175/211 (82.94%), Postives = 183/211 (86.73%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QAAATLMQPTKVGV PAR             KAFGV+ A AR++CSL  +LKDLAQK  DA K+AGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGV SFAFKPGKY AKKFCLEPTSFTVKAE VNKNAPPDFQ TKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVTVQL GGERVPFLFTI
Sbjct:    6 QAAATLMQPTKVGVAPARNNLQLRSAQSVS-KAFGVEPAAARLTCSLQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTI 215          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_SOLLC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum lycopersicum GN=PSBO PE=2 SV=2)

HSP 1 Score: 333.183 bits (853), Expect = 7.182e-91
Identity = 169/211 (80.09%), Postives = 180/211 (85.31%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QAAATLMQPTKVGV                 KAFGV+    R++CSL  ++K+LAQKC DA KIAGFALATSALVVSGA+AEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTI+GGV SFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVTVQL GGERVPFLFTI
Sbjct:    6 QAAATLMQPTKVGV----RNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTI 212          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_PEA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Pisum sativum GN=PSBO PE=2 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 3.689e-87
Identity = 162/211 (76.78%), Postives = 179/211 (84.83%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QAAATLMQPTK+     R+            KAFG++  GA+++CSL +D K+LA KCV+A+KIAGFALATSALVVSGASAEG PKRLT+DEIQSKTY+EVKGTGTANQCPTIDGGVDSF+FKPGKY AKK CLEPTSFTVK+EGV KN P  FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVTVQL GGERVPFLFTI
Sbjct:    6 QAAATLMQPTKL-----RSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVEASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTI 211          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO2_ARATH (Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana GN=PSBO2 PE=1 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 5.327e-86
Identity = 157/211 (74.41%), Postives = 176/211 (83.41%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QAAAT +QP K+   P+R             K+FG+DS+ AR++CSL++DLKD A KC DA KIAGFALATSALVVSGA AEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FK GKY  KKFC EPTSFTVKA+ V+KNAPPDFQNTKLMTRLTYTLDEIEGPFEV  DG++KF E+DGIDYAAVTVQL GGERVPFLFT+
Sbjct:    6 QAAATFLQPAKIAASPSRNVHLRSNQTVG--KSFGLDSSQARLTCSLHSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQLPGGERVPFLFTV 214          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_FRIAG (Oxygen-evolving enhancer protein 1, chloroplastic OS=Fritillaria agrestis GN=PSBO PE=2 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 6.957e-86
Identity = 161/212 (75.94%), Postives = 182/212 (85.85%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGA-RISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QAAATL+ P KVG  PART            KAFG D++ A R++CS+N+DL+D+AQKC DA K+AGFALATSALV+SGASAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG +SF +K GKY  KK CLEPTSFTVKAEG+NKNAPP+FQ TKLMTRLTYTLDEIEGPFEV+PDGT+KF EKDGIDYAAVTVQL GGERVPFLFT+
Sbjct:    6 QAAATLI-PAKVGA-PARTHLRSNSHLS---KAFGFDNSTAGRLTCSINSDLRDIAQKCTDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTESFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTV 212          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_SPIOL (Oxygen-evolving enhancer protein 1, chloroplastic OS=Spinacia oleracea GN=PSBO PE=1 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.894e-83
Identity = 160/213 (75.12%), Postives = 176/213 (82.63%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSA--GARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QA+ T +QPTKV    A              KAFGV+SA  G R+S SL +DLK+LA KCVDATK+AG ALATSAL+ SGA+AEG  KRLTYDEIQSKTY+EVKGTGTANQCPT++GGVDSFAFKPGKY AKKFCLEPT F VKAEG++KN+ PDFQNTKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVTVQL GGERVPFLFTI
Sbjct:    6 QASTTFLQPTKV----ASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANKCVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTI 213          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO1_ARATH (Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana GN=PSBO1 PE=1 SV=2)

HSP 1 Score: 306.22 bits (783), Expect = 9.402e-83
Identity = 149/211 (70.62%), Postives = 172/211 (81.52%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            Q+ AT +Q  K+   P+R             K+FG++++ AR++CS  +D KD   KC DA KIAGFALATSALVVSGASAEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FKPGKY  KKFC EPTSFTVKA+ V+KNAPP+FQNTKLMTRLTYTLDEIEGPFEV+ DG++ F E+DGIDYAAVTVQL GGERVPFLFT+
Sbjct:    6 QSTATFLQSAKIATAPSR-GSSHLRSTQAVGKSFGLETSSARLTCSFQSDFKDFTGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQLPGGERVPFLFTV 215          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_WHEAT (Oxygen-evolving enhancer protein 1, chloroplastic OS=Triticum aestivum GN=PSBO PE=2 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 8.237e-79
Identity = 152/211 (72.04%), Postives = 171/211 (81.04%), Query Frame = 3
Query:    3 QAAATLMQPTKVGVVPARTXXXXXXXXXXXXKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTI 635
            QAAAT+M P K+G   +              +AFGVD AGARI+CSL +D++++A KC DA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSF FK GKY+ KKFCLEPTSFTVKAEG+ KN PP FQ TKLMTRLTYTLDE+EGP EV    T+KF EKDGIDYAAVTVQL GGERV FLFT+
Sbjct:    6 QAAATVM-PAKIGGRASSARPSSHVA-----RAFGVD-AGARITCSLQSDIREVASKCADAAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRRTLKFEEKDGIDYAAVTVQLPGGERVAFLFTV 209          
BLAST of FC869203 vs. ExPASy Swiss-Prot
Match: PSBO_VOLCA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Volvox carteri GN=PSBO PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.203e-37
Identity = 79/149 (53.02%), Postives = 97/149 (65.10%), Query Frame = 3
Query:  201 FALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID-GGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLAGGERVPFLFTINNW 644
            F  A +A+V + A   G    LTYDE+Q  TY++VKGTG AN CP ++ G  D      G Y+ + FC+EPTSFTVK E V K    +F  TKLMTRLTYTLD + G  +V  DG+ +  E+DGIDYAA TVQL GGERV FLFTI  +
Sbjct:   32 FGQAAAAVVAASALVAGSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTVKEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQLPGGERVAFLFTIKQF 180          
The following BLAST results are available for this feature:
BLAST of FC869203 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
PSBO_SOLTU9.065e-9482.46Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_TOBAC1.184e-9382.94Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLLC7.182e-9180.09Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_PEA3.689e-8776.78Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO2_ARATH5.327e-8674.41Oxygen-evolving enhancer protein 1-2, chloroplasti... [more]
PSBO_FRIAG6.957e-8675.94Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SPIOL1.894e-8375.12Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO1_ARATH9.402e-8370.62Oxygen-evolving enhancer protein 1-1, chloroplasti... [more]
PSBO_WHEAT8.237e-7972.04Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_VOLCA1.203e-3753.02Oxygen-evolving enhancer protein 1, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31009F05EF AbioticL1 Citrus clementina cDNA clone C31009F05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869203 ID=FC869203; Name=FC869203; organism=Citrus clementina; type=EST; length=652bp
TACAAGCCGCAGCTACACTGATGCAACCCACCAAGGTGGGTGTGGTACCC
GCTCGCACCAGCAGCCTGCAGCTGAGGTCTTCACAGAGCGTTTCGAAGGC
TTTTGGTGTCGACTCAGCTGGTGCTAGGATCTCTTGCTCTTTGAATAATG
ACTTGAAGGATTTGGCTCAGAAATGTGTTGATGCTACCAAGATCGCTGGC
TTTGCCCTCGCCACTTCTGCTCTCGTCGTTTCGGGAGCAAGTGCTGAAGG
TGTTCCAAAGAGGCTAACCTATGATGAAATCCAGAGCAAGACATACATGG
AAGTGAAGGGAACCGGAACTGCTAACCAGTGCCCAACCATTGATGGCGGA
GTTGACTCTTTTGCCTTCAAACCTGGCAAATACCAGGCTAAGAAGTTCTG
CCTAGAACCAACTTCCTTCACTGTCAAGGCTGAGGGTGTCAACAAGAATG
CCCCACCAGATTTCCAGAACACCAAGCTCATGACCCGCCTTACCTACACC
CTTGACGAGATTGAGGGACCTTTTGAAGTGTCCCCCGATGGCACCATTAA
GTTTGTGGAGAAGGATGGAATTGACTATGCTGCTGTGACAGTTCAGCTGG
CTGGAGGCGAGCGTGTGCCCTTCCTTTTCACCATCAACAATTGGTAGCAT
CA
back to top