FC869204

Overview
NameFC869204
Unique NameFC869204
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length630
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869204 vs. ExPASy Swiss-Prot
Match: Y4648_ARATH (Uncharacterized protein At4g26480 OS=Arabidopsis thaliana GN=At4g26480 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.489e-39
Identity = 81/161 (50.31%), Postives = 103/161 (63.98%), Query Frame = 2
Query:  131 EKWIMHYSSKHQILLVGEGDFSFSFALLQKFGSASNICASSLDSYETVVKKFKEARSNLDTLKKLGASIIHGVDATEMKEHSELSKRKFDRIIFNFPHAG--FHGKEEDDEVIRMHMSLVEGFFRNASGMLRPRGEVHVSHKTTAPFCKWHIEELARKHSL 607
            EKWI HYSS H+ILLVGEG+FSFS  L   FGSA NI A+SLDS + +  K+ +A  N++ LK+ G  I H VD   M   + LS +++DRI+FNFPHAG  F G+E     I  H  LV GF  NA  ML   GE+H++HKTT PF  W I++L +   L
Sbjct:    5 EKWIRHYSSTHKILLVGEGNFSFSLCLASAFGSAMNITATSLDSEDELSIKYMDAVDNINILKRYGCDIQHEVDVHTMSFDNSLSLQRYDRIVFNFPHAGSRFFGRELSSRAIESHKELVRGFLENAKEMLEEDGEIHITHKTTYPFSDWGIKKLGKGEGL 165          
BLAST of FC869204 vs. ExPASy Swiss-Prot
Match: YC6D_SCHPO (UPF0617 protein C1919.13c OS=Schizosaccharomyces pombe GN=SPCC1919.13c PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.126e-20
Identity = 49/162 (30.25%), Postives = 98/162 (60.49%), Query Frame = 2
Query:  113 KDEKEEEKWIMHYSSKHQILLVGEGDFSFSFALLQKFGSASN-ICASSLDSYETVVKKFKEARSNLDTLKKLGASIIHGVDATEMKEHSELSKRKFDRIIFNFPHAGFHGKEEDDEVIRMHMSLVEGFFRNASGMLRPRGEVHVSHKTTAPFCKWHIEELAR 595
            K++   E++++ +   ++ LL+GEG+FSF+F+LL    S+   + A+S DS E + +K+ +A   +  ++  G  ++H +DAT++  H +L  +KFD I +NFPH+G  G ++ D  I  +  ++  FF+ +  +L  +G + ++   T P+  W+++ LA+
Sbjct:   42 KNKGPTERYVLPFEKNNRFLLLGEGNFSFAFSLLLHHVSSEGFVLATSYDSKEDLKQKYPDAAEYISKIEINGGKVMHEIDATKLHLHKKLKTQKFDTIFWNFPHSG-KGIKDQDRNILDNQKMLLAFFKASKFLLSEKGVIVITLAETKPYTLWNLKGLAK 202          
BLAST of FC869204 vs. ExPASy Swiss-Prot
Match: FDXA1_HUMAN (Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens GN=FDXACB1 PE=2 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 7.325e-13
Identity = 43/127 (33.86%), Postives = 71/127 (55.91%), Query Frame = 2
Query:  164 QILLVGEGDFSFSFALLQKFGSASNICASSLDSYETVVKKFKEARSNLDTLKKLGASIIHGVDATEMKEHSELSKRKFDRIIFNFPHAGFHGKEEDDEVIRMHMSLVEGFFRNASGMLRPRGEVHVS 544
            ++LLVGEG+FSF+ AL +    ++ + A+ L     + +    A  NL  L++ G  +  GVD T++ +  EL +R+FD+I FNFPH G          +  +  L+  FF++ + +L   GEVHV+
Sbjct:    5 RLLLVGEGNFSFAAALSETLDQSTQLTATCLQRPAELARD-PLAWENLQCLRERGIDVRFGVDCTQLADVFELHEREFDQIYFNFPHCGRKAG------VAKNRELLAKFFQSCADVLAEEGEVHVA 124          
BLAST of FC869204 vs. ExPASy Swiss-Prot
Match: FDXA1_MOUSE (Ferredoxin-fold anticodon-binding domain-containing protein 1 homolog OS=Mus musculus GN=Fdxacb1 PE=2 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.356e-11
Identity = 40/127 (31.50%), Postives = 66/127 (51.97%), Query Frame = 2
Query:  164 QILLVGEGDFSFSFALLQKFGSASNICASSLDSYETVVKKFKEARSNLDTLKKLGASIIHGVDATEMKEHSELSKRKFDRIIFNFPHAGFHGKEEDDEVIRMHMSLVEGFFRNASGMLRPRGEVHVS 544
            ++LLVGEG+FSF+ +L+     + ++ A+    +   ++    A  NL  L++ G  +  GVD T++        R FDRI FNFPH G          +  +  L+  FF++ + +L   GEVHV+
Sbjct:    5 RLLLVGEGNFSFAASLIDGLDPSVSVTATGFQ-HRAALEGDPVALENLKRLRERGVEVRFGVDCTQLSHALPADDRDFDRIYFNFPHCGRKAG------VAKNRELLAKFFQSCADVLAKAGEVHVT 124          
The following BLAST results are available for this feature:
BLAST of FC869204 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
Y4648_ARATH3.489e-3950.31Uncharacterized protein At4g26480 OS=Arabidopsis t... [more]
YC6D_SCHPO2.126e-2030.25UPF0617 protein C1919.13c OS=Schizosaccharomyces p... [more]
FDXA1_HUMAN7.325e-1333.86Ferredoxin-fold anticodon-binding domain-containin... [more]
FDXA1_MOUSE2.356e-1131.50Ferredoxin-fold anticodon-binding domain-containin... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31009F06EF AbioticL1 Citrus clementina cDNA clone C31009F06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869204 ID=FC869204; Name=FC869204; organism=Citrus clementina; type=EST; length=630bp
AGTGCTCAACTCTCCCTGTATTAAAGACACCGACCCTTGAATCTCGATGG
CAAAAGTAGTAGTGGGTATGGCTGCTAAAGGAGAACAGAAAAAAGAAATT
AGTTTTACAGAAAAAGATGAAAAAGAAGAAGAGAAATGGATCATGCATTA
TTCATCAAAGCATCAAATATTGTTGGTGGGTGAAGGAGATTTCTCGTTTT
CTTTTGCTTTATTGCAGAAATTTGGCTCTGCTTCTAACATCTGCGCTTCT
TCTCTTGATTCCTATGAAACTGTGGTTAAGAAATTCAAGGAGGCACGGTC
AAATTTGGACACCCTAAAGAAGCTGGGAGCATCCATTATCCATGGAGTTG
ATGCAACTGAAATGAAGGAACATTCTGAATTGAGCAAGCGGAAGTTTGAT
AGAATAATCTTCAACTTCCCCCATGCTGGCTTTCATGGAAAGGAAGAAGA
CGACGAAGTTATTCGAATGCATATGAGCCTCGTGGAAGGTTTCTTCAGAA
ATGCAAGTGGTATGCTAAGGCCTCGTGGTGAAGTTCATGTAAGCCACAAG
ACAACAGCTCCATTTTGCAAATGGCATATCGAGGAACTCGCTAGGAAACA
CTCTTTGTTAAGACTCGACTGTGTGCAGTT
back to top