FC869211

Overview
NameFC869211
Unique NameFC869211
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length639
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT_PEA (Triose phosphate/phosphate translocator, chloroplastic OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 2.728e-71
Identity = 142/208 (68.27%), Postives = 154/208 (74.04%), Query Frame = 2
Query:   17 MESRVLSRATTATTISSLRSSPGENHQNVSFVSLKPIGAVGEGGNVIWGRQLRPALLLESSSAPAGLFSGKKEILRPILATASSPAEGSDSTGE--AAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            MESRVLSRATT +++ +L         N S  S+K  G+V +GGN++WGRQLRP L        A L       LRP  ATA     G+DS GE   APVGFF RYPAL TGFFFF WYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCLVSW VGLPKRAPID   LKLLIPVAVCHALGHVTSNVSFAAVAVSFTHT+K L
Sbjct:    1 MESRVLSRATTLSSLPTLNKLHRLPLANASLPSVKSFGSVSDGGNLVWGRQLRPELCSPVLKKGASL-------LRPCPATAG----GNDSAGEEKVAPVGFFSRYPALTTGFFFFTWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLVSWTVGLPKRAPIDGNLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTVKAL 197          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT_FLAPR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria pringlei GN=TPT PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 5.689e-69
Identity = 138/209 (66.03%), Postives = 152/209 (72.73%), Query Frame = 2
Query:   17 MESRVLSR-ATTATTISSLRSSPGENHQNVSFVSLKPIGAVGEGGNVIWGRQLRPALLLESSSAPAGLFSG--KKEILRPILATASSPAEGSDSTGEAAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            MESRVLS  ATT + I  L    G            P      GGN++WGRQLRP+LL    S+P  L +   K+++L+P  ATAS      DS G+AAPVGFF +YP LVTGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVS IHL VGVVYCL  WAVGLPKRAP+DS  LKLLIPVA CHALGHVTSNVSFAAVAVSFTHTIK L
Sbjct:    1 MESRVLSSGATTISGIPRLTRPAGRTTTTTVVAVASPAKLNTNGGNLVWGRQLRPSLLNLDHSSPVSLVTKPVKRDVLKPCTATAS------DSAGDAAPVGFFAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSAIHLAVGVVYCLGGWAVGLPKRAPMDSNLLKLLIPVAFCHALGHVTSNVSFAAVAVSFTHTIKSL 203          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT_FLATR (Triose phosphate/phosphate translocator, chloroplastic OS=Flaveria trinervia GN=TPT PE=2 SV=1)

HSP 1 Score: 258.455 bits (659), Expect = 2.162e-68
Identity = 135/208 (64.90%), Postives = 150/208 (72.12%), Query Frame = 2
Query:   17 MESRVLSRATTATTISSLRSSPGENHQNVSFVSLKPIGAVGEGGNVIWGRQLRPALLLESSSAPAGLFSG--KKEILRPILATASSPAEGSDSTGEAAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            MESRVLS   TA +     + P       +     P      GGNV+WGRQLRP+LL    S+P  L +   K+++L+P  ATAS      DS G+AAPVGF  +YP LVTGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCL SW VGLPKRAP+DS  LKLLIPV  CHALGHVTSNVSFAAVAVSFTHTIK L
Sbjct:    1 MESRVLSSGATAISGVPRLTKPAGRITTTTVAVAFPARLNATGGNVVWGRQLRPSLLNLDHSSPVSLVTKPVKRDVLKPCSATAS------DSAGDAAPVGFLAKYPFLVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLGSWTVGLPKRAPVDSNILKLLIPVGFCHALGHVTSNVSFAAVAVSFTHTIKAL 202          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT1_BRAOB (Triose phosphate/phosphate translocator, chloroplastic OS=Brassica oleracea var. botrytis GN=TPT PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 6.954e-67
Identity = 139/213 (65.26%), Postives = 157/213 (73.71%), Query Frame = 2
Query:   17 MESRVLSRAT-TATTISSLRSSPGENHQNVSFVS------LKPIGAVGEGGNVIWGRQLRPALLLESSSAPAGLFSGKKEILRPILATASSPAEGSDSTGEAAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            MESRVL RAT T T +  LR      ++  S  S       KPIG++GEGGN+I GRQLRP LLL+S          K+EIL+P+ A +   AEG DS GE   VGF  +YP LVTG    MWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCLVSW+VGLPKRAP++S  LK+LIPVAVCHA+GHVTSNVSFAAVAVSFTHTIK L
Sbjct:    1 MESRVLLRATETVTGVPQLRRPIRAINRQFSTASSSFTAFAKPIGSIGEGGNLISGRQLRPLLLLDS-------LPEKREILKPVRAAS---AEGGDSAGETK-VGFLGKYPWLVTGILLLMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLFVGVVYCLVSWSVGLPKRAPVNSDILKVLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKAL 202          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT_SPIOL (Triose phosphate/phosphate translocator, chloroplastic OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 2.237e-65
Identity = 130/208 (62.50%), Postives = 147/208 (70.67%), Query Frame = 2
Query:   17 MESRVLSRATTATTISSLRSSPGENHQNVSFVS--LKPIGAVGEGGNVIWGRQLRPALLLESSSAPAGLFSGKKEILRPILATASSPAEGSDSTGEAAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            MESRVLSR T    +  L   P     +  F +    P+G V +GG++ WGRQLRP LLLE      G    ++E       TA  P   +  +   A  GF ++YPALVTG FFFMWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCL SW+VGLPKRAP+DSK LKLLIPVAVCHA+GHVTSNVSFAAVAVSFTHTIK L
Sbjct:    1 MESRVLSRTTAIAALPKL-FRPSREAASFGFATGVKTPVGLVKDGGSLTWGRQLRPVLLLEP--VQTGPVCSRRE------KTAVQPCRAASGSSGEAKTGFLEKYPALVTGSFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLFVGVVYCLASWSVGLPKRAPMDSKLLKLLIPVAVCHAIGHVTSNVSFAAVAVSFTHTIKAL 199          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT_SOLTU (Triose phosphate/phosphate translocator, chloroplastic OS=Solanum tuberosum GN=TPT PE=2 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.228e-63
Identity = 125/175 (71.43%), Postives = 140/175 (80.00%), Query Frame = 2
Query:  110 VSLKPIGAVGEGGNVIWGRQLRPALLLESSSAPAGLFSGKKEILRPILATASSPAEGSDSTGEAAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            V+ KP+G +  G N+IWGRQLRPA+LLE+S         K+E ++P  A ASS A  SDS+G+A  VGFF++   L TGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVSVIHL VGVVYCLVSW VGLPKRAPIDS  LKLL PVA CHALGHVTSNVSFAAV VSFTHT+K L
Sbjct:   45 VTAKPVGPLIAGPNLIWGRQLRPAILLETSP--------KRESIKPCSAAASSSAGSSDSSGDAK-VGFFNK-ATLTTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSVIHLAVGVVYCLVSWGVGLPKRAPIDSTQLKLLTPVAFCHALGHVTSNVSFAAVRVSFTHTVKAL 209          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT_MAIZE (Triose phosphate/phosphate translocator, chloroplastic OS=Zea mays GN=TPT PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 8.797e-62
Identity = 114/174 (65.52%), Postives = 138/174 (79.31%), Query Frame = 2
Query:  113 SLKPIGAVGEGGNVIWGRQLRPALLLESSSAPAGLFSGKKEILRPILATASSPAEGSDSTGEAAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            ++K   AV +   ++WGRQLRPALLL ++  P+ L   ++  L+P       PA  ++S GEA  VGF ++YPALVTGFFFFMWYFLNVIFNILNK+IYNYFPYPYFVS+IHL+VGVVYCL+SW+VGLPKRAPI+   LKLL PVA+CH +GH+TSNVSFAAVAVSF HTIK L
Sbjct:   40 TVKCAAAVPDAAPIVWGRQLRPALLLPAALLPS-LQPARRHTLQP-------PAAAAESAGEAKSVGFLEKYPALVTGFFFFMWYFLNVIFNILNKKIYNYFPYPYFVSLIHLVVGVVYCLISWSVGLPKRAPINGTLLKLLFPVALCHGIGHITSNVSFAAVAVSFAHTIKAL 205          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: GPT1_ARATH (Glucose-6-phosphate/phosphate translocator 1, chloroplastic OS=Arabidopsis thaliana GN=GPT1 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 5.218e-22
Identity = 48/98 (48.98%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  335 LVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIK 628
            L  G +F  W+ LNV+FNI NK++ N +PYP+  S + L  G +  L+SWAVG+ +    D  F K L PVAV H +GHV + VS + VAVSFTH IK
Sbjct:   95 LKIGIYFATWWALNVVFNIYNKKVLNAYPYPWLTSTLSLAAGSLMMLISWAVGIVETPKTDFDFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIK 192          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: GPT2_ARATH (Glucose-6-phosphate/phosphate translocator 2, chloroplastic OS=Arabidopsis thaliana GN=GPT2 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.417e-21
Identity = 48/98 (48.98%), Postives = 61/98 (62.24%), Query Frame = 2
Query:  335 LVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIK 628
            L  G +F  W+ LNV+FNI NK++ N FPYP+  S + L  G +  LVSWA  +      D +F K L PVAV H +GHV + VS + VAVSFTH IK
Sbjct:   95 LKIGIYFATWWALNVVFNIYNKKVLNAFPYPWLTSTLSLACGSLMMLVSWATRIADAPKTDLEFWKTLFPVAVAHTIGHVAATVSMSKVAVSFTHIIK 192          
BLAST of FC869211 vs. ExPASy Swiss-Prot
Match: TPT2_BRAOB (Triose phosphate/phosphate translocator, non-green plastid, chloroplastic OS=Brassica oleracea var. botrytis GN=NGTPT PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.970e-18
Identity = 54/155 (34.84%), Postives = 79/155 (50.97%), Query Frame = 2
Query:  188 LESSSAPAGLFSGKKEILRPILAT------ASSPAEGSDSTGEAAPVGFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKFLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKLL 634
            L SS +P   +SG   +  P L T      A++  E  + +G+   V        L  G  F MWY  N+ FNI NK++      P  V+++   VG V     WA+ L KR  I +  L  ++P+AV H LG++ +N+S   V+VSFTHTIK +
Sbjct:   53 LASSDSPLRAWSGLPSVSSPSLDTNRFKTAATAVPEEGEGSGKMTKV--------LELGLLFAMWYLFNIYFNIYNKQVLKALHAPMTVTLVQFAVGSVLITFMWALNLYKRPKISAAQLAAILPLAVVHTLGNLFTNMSLGKVSVSFTHTIKAM 199          
The following BLAST results are available for this feature:
BLAST of FC869211 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
TPT_PEA2.728e-7168.27Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLAPR5.689e-6966.03Triose phosphate/phosphate translocator, chloropla... [more]
TPT_FLATR2.162e-6864.90Triose phosphate/phosphate translocator, chloropla... [more]
TPT1_BRAOB6.954e-6765.26Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SPIOL2.237e-6562.50Triose phosphate/phosphate translocator, chloropla... [more]
TPT_SOLTU1.228e-6371.43Triose phosphate/phosphate translocator, chloropla... [more]
TPT_MAIZE8.797e-6265.52Triose phosphate/phosphate translocator, chloropla... [more]
GPT1_ARATH5.218e-2248.98Glucose-6-phosphate/phosphate translocator 1, chlo... [more]
GPT2_ARATH4.417e-2148.98Glucose-6-phosphate/phosphate translocator 2, chlo... [more]
TPT2_BRAOB5.970e-1834.84Triose phosphate/phosphate translocator, non-green... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31009G01EF AbioticL1 Citrus clementina cDNA clone C31009G01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869211 ID=FC869211; Name=FC869211; organism=Citrus clementina; type=EST; length=639bp
CCACAGCGGTGACATGATGGAGTCGCGAGTGCTGTCACGCGCCACCACCG
CCACCACCATTTCAAGCCTCCGAAGTTCGCCGGGTGAGAACCACCAAAAC
GTCAGCTTCGTCTCGTTGAAGCCGATTGGAGCCGTTGGTGAAGGCGGGAA
TGTCATTTGGGGAAGACAGCTACGTCCTGCTCTGCTCCTCGAGAGCTCCA
GTGCTCCGGCTGGTCTTTTCTCCGGAAAGAAGGAGATTCTCCGTCCAATC
CTCGCCACCGCTTCTTCTCCTGCCGAAGGAAGCGATTCCACCGGAGAAGC
CGCTCCGGTCGGATTCTTTGACAGGTATCCGGCCCTCGTGACCGGGTTCT
TCTTCTTCATGTGGTACTTTCTGAACGTGATATTCAACATTCTTAACAAG
AGGATTTACAATTACTTCCCATATCCTTATTTTGTGTCCGTTATTCATTT
GTTGGTTGGGGTGGTTTACTGTTTGGTGAGCTGGGCTGTGGGCCTTCCCA
AGCGAGCTCCTATTGATTCAAAATTCCTGAAGCTGTTAATCCCTGTTGCT
GTGTGTCATGCATTGGGCCATGTTACCAGCAACGTGTCTTTTGCAGCAGT
TGCTGTCTCCTTTACTCATACCATCAAGCTCTTGAGCCC
back to top