FC869288

Overview
NameFC869288
Unique NameFC869288
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length650
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC869288 vs. ExPASy Swiss-Prot
Match: COG8_HUMAN (Conserved oligomeric Golgi complex subunit 8 OS=Homo sapiens GN=COG8 PE=1 SV=2)

HSP 1 Score: 169.859 bits (429), Expect = 1.052e-41
Identity = 88/221 (39.82%), Postives = 129/221 (58.37%), Query Frame = 3
Query:    3 LANHSTLLDLLEIPQLMDTCVRNGNYDEALDLEAYVCKLSTLHPKLPIIQALAAEVXXXXXXXXXXXXXXXRSNIQLPECLRIIGYLRRIGVFSEYEMRLQFLRCREAWLTGILEDLDQKNAYEYLKGMINCHRMHLFDVVNQYRAIFADD------TSGSEENYDGGLLFSWAMHQITAHLKTLKVMLPKITEGVSLSNILDQCMYCAMXXXXXXXDFRG 647
            L  H+ +L++LEIPQLMDTCVRN  Y+EAL+L AYV +L   +  +P+IQ +  EV               R+NIQLP CLR+IGYLRR+ VF+E E+R++FL+ R+AWL  IL  +   + Y ++   I   R+HLFD++ QYRAIF+D+        G     +  +   W + +++  L+ L+  L +   G  L ++L QCMY  +       DFRG
Sbjct:  146 LNRHTEILEILEIPQLMDTCVRNSYYEEALELAAYVRRLERKYSSIPVIQGIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGYLRRMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEASRVHLFDIITQYRAIFSDEDPLLPPAMGEHTVNESAIFHGWVLQKVSQFLQVLETDLYRGIGG-HLDSLLGQCMYFGLSFSRVGADFRG 365          
BLAST of FC869288 vs. ExPASy Swiss-Prot
Match: COG8_MOUSE (Conserved oligomeric Golgi complex subunit 8 OS=Mus musculus GN=Cog8 PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 1.794e-41
Identity = 89/221 (40.27%), Postives = 130/221 (58.82%), Query Frame = 3
Query:    3 LANHSTLLDLLEIPQLMDTCVRNGNYDEALDLEAYVCKLSTLHPKLPIIQALAAEVXXXXXXXXXXXXXXXRSNIQLPECLRIIGYLRRIGVFSEYEMRLQFLRCREAWLTGILEDLDQKNAYEYLKGMINCHRMHLFDVVNQYRAIFADD------TSGSEENYDGGLLFSWAMHQITAHLKTLKVMLPKITEGVSLSNILDQCMYCAMXXXXXXXDFRG 647
            L  H+ +L++LEIPQLMDTCVRN  ++EAL+L AYV +L   +  +P+IQ +  EV               R+NIQLP CLR+IGYLRR+ VF+E E+R++FL+ R+AWL  IL  +   + Y ++   I   R+HLFD++ QYRAIF+D+        G     +G +   W + +I+  L+ L+  L +   G  L ++L QCMY  +       DFRG
Sbjct:  152 LNRHTEILEILEIPQLMDTCVRNSYHEEALELAAYVRRLERKYSSIPVIQGIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGYLRRMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEACRVHLFDIITQYRAIFSDEDPLLPPAMGEYTVNEGAIFHGWVLQKISQFLQVLETDLYRGIGG-RLDSLLGQCMYFGLSFSRVGADFRG 371          
BLAST of FC869288 vs. ExPASy Swiss-Prot
Match: COG8_BOVIN (Conserved oligomeric Golgi complex subunit 8 OS=Bos taurus GN=COG8 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.519e-40
Identity = 86/221 (38.91%), Postives = 129/221 (58.37%), Query Frame = 3
Query:    3 LANHSTLLDLLEIPQLMDTCVRNGNYDEALDLEAYVCKLSTLHPKLPIIQALAAEVXXXXXXXXXXXXXXXRSNIQLPECLRIIGYLRRIGVFSEYEMRLQFLRCREAWLTGILEDLDQKNAYEYLKGMINCHRMHLFDVVNQYRAIFADD------TSGSEENYDGGLLFSWAMHQITAHLKTLKVMLPKITEGVSLSNILDQCMYCAMXXXXXXXDFRG 647
            L  H+ +L++LEIPQLMDTCVRN  Y+EAL+L AYV +L   +  +P+IQ +  EV               R+NIQLP CLR+IG+LR++ VF+E E+R++FL+ R+AWL  IL  +   + Y ++   I   R+HLFD++ QYRAIF+D+        G     +  +   W + +++  L+ L+  L +   G  L ++L QCMY  +       DFRG
Sbjct:  152 LNRHTEILEILEIPQLMDTCVRNSYYEEALELAAYVRRLERKYSSIPVIQGIVNEVRQSMQLMLSQLIQQLRTNIQLPACLRVIGFLRQMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEACRVHLFDIITQYRAIFSDEDPLLPPAMGEHMVNESAIFHGWVLQKVSQFLQVLETDLNR-GIGSRLDSLLGQCMYFGLSFSRVGADFRG 371          
BLAST of FC869288 vs. ExPASy Swiss-Prot
Match: COG8_DICDI (Conserved oligomeric Golgi complex subunit 8 OS=Dictyostelium discoideum GN=cog8 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.626e-34
Identity = 77/217 (35.48%), Postives = 121/217 (55.76%), Query Frame = 3
Query:    3 LANHSTLLDLLEIPQLMDTCVRNGNYDEALDLEAYVCKLSTLHPKLPIIQALAAEVXXXXXXXXXXXXXXXRSNIQLPECLRIIGYLRRIGVFSEYEMRLQFLRCREAWLTGILE-DLDQKNAYEYLKGMINCHRMHLFDVVNQYRAIFADDTSGSEENYDGGLLFSWAMHQITAHLKTLKVMLPKITEGVSLSNILDQCMYCAMXXXXXXXDFRGL 650
            L N STLLD+LEIPQLMDTC++N ++DEAL LE++  K+   +    +I  +  E+               R +I L  C++ IGYLRR+ ++ E E+++ FL  R+ WL   L+ D+   N   YL  + +  R ++FD+V QY AIF+++ S  E+  D  +L++W   +I  ++  +   L  I  G S+S +L+  MY +M       DFR L
Sbjct:   77 LDNFSTLLDILEIPQLMDTCIKNNSFDEALQLESFAKKIYKQYSNNTVIIEIIKEIKVCTRSLISTLQQQLRQDITLTNCIKTIGYLRRLSIYKENELKIIFLHSRDQWLINSLKFDITNSNHVTYLTKLTDSCRTNIFDIVTQYNAIFSNE-SNDEDQLDDLILYNWIQQKIKVYINIVDSTLNHIKSGSSISYVLENSMYFSMSISRVGIDFRNL 292          
BLAST of FC869288 vs. ExPASy Swiss-Prot
Match: COG8_DROME (Conserved oligomeric Golgi complex subunit 8 OS=Drosophila melanogaster GN=CG6488 PE=1 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.054e-33
Identity = 81/227 (35.68%), Postives = 129/227 (56.83%), Query Frame = 3
Query:    3 LANHSTLLDLLEIPQLMDTCVRNGNYDEALDLEAYVCKLSTLHPKLPIIQALAAEVXXXXXXXXXXXXXXXRSNIQLPECLRIIGYLRRIGVFSEYEMRLQFLRCREAWLTGILEDLDQKNAYEYLKGMINCHRMHLFDVVNQYRAIFADD-----TSGSEENYDG------GLLFSWAMHQITAHLKTLKVMLPKITEGVSLSNILDQCMYCAMXXXXXXXDFRGL 650
            L  ++ LL++LE+PQLM+ C+R G Y+EAL+L AY  +L      +P++ ++   V               R+++QLP+CL+I+GYLRR+  F + E+RL+FL+ R+AWLT  LE +   +A ++L   I   R++LF+++ QYRAIF +D     T  S     G       L  +W  ++I+  L+TL+  L ++  G S+  +L QCMY  +       DFR L
Sbjct:  133 LQKNAQLLEVLELPQLMERCIREGRYEEALELAAYATRLGQHQGHIPVVTSIVRSVEALWHNMLVQLVAQLRTDLQLPKCLQIVGYLRRMQAFGDNELRLKFLQARDAWLTSCLEAIPTADAQQHLSKTIEITRINLFNIITQYRAIFPEDEGTLKTQSSLRPLQGVSCNGDRLFQAWLHNKISDFLQTLERDL-QLGVG-SVETVLGQCMYFGLSFSRVGADFRAL 357          
The following BLAST results are available for this feature:
BLAST of FC869288 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
COG8_HUMAN1.052e-4139.82Conserved oligomeric Golgi complex subunit 8 OS=Ho... [more]
COG8_MOUSE1.794e-4140.27Conserved oligomeric Golgi complex subunit 8 OS=Mu... [more]
COG8_BOVIN1.519e-4038.91Conserved oligomeric Golgi complex subunit 8 OS=Bo... [more]
COG8_DICDI1.626e-3435.48Conserved oligomeric Golgi complex subunit 8 OS=Di... [more]
COG8_DROME1.054e-3335.68Conserved oligomeric Golgi complex subunit 8 OS=Dr... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31010F01EF AbioticL1 Citrus clementina cDNA clone C31010F01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869288 ID=FC869288|Name=FC869288|organism=Citrus clementina|type=EST|length=650bp
TGCTAGCGAATCACAGTACTTTGCTTGACTTGCTTGAAATCCCTCAACTT
ATGGACACATGTGTAAGAAATGGAAATTATGATGAAGCTCTTGACTTAGA
AGCATATGTATGCAAACTTTCGACCTTGCACCCCAAGTTACCTATTATTC
AAGCACTGGCTGCAGAAGTTAAGCAGACAACCCAATCTCTTCTTTCTCAA
CTTCTTCAGAAACTTCGCTCTAATATCCAGTTACCAGAATGTCTCCGAAT
TATTGGATATTTACGTCGCATTGGAGTATTTAGTGAGTATGAAATGCGAT
TACAGTTTTTAAGATGTCGAGAGGCTTGGCTTACTGGAATTCTTGAGGAT
TTGGACCAGAAAAATGCTTATGAGTACTTGAAAGGGATGATAAACTGTCA
CAGAATGCATCTTTTTGATGTTGTTAACCAATATAGAGCAATATTTGCTG
ATGATACTTCAGGAAGTGAAGAAAATTATGATGGCGGCCTTCTTTTTAGT
TGGGCCATGCATCAAATTACTGCACACCTTAAAACTCTTAAAGTCATGCT
CCCAAAGATAACCGAGGGTGTATCTCTGTCAAATATTTTGGATCAATGCA
TGTATTGTGCTATGGGACTTGGCTTGGGTGGACTGGATTTTCGGGGCTTG
back to top