FC869289

Overview
NameFC869289
Unique NameFC869289
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9474 contig Ccv1_Contig9474:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869289 vs. ExPASy Swiss-Prot
Match: WIP1_ARATH (WPP domain-interacting protein 1 OS=Arabidopsis thaliana GN=WIP1 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.381e-22
Identity = 81/207 (39.13%), Postives = 106/207 (51.21%), Query Frame = 1
Query:   79 KSERSAHESVEDNVVVSQGAVSHVNDDNSVKINGSYVNE---LVSSDNHDANVAPVDCKETGDQGLAMKSPTGGSPPMKKGYGLKKWRRIKRDFVKDAGPSVDSSKILKRGLSGAVNP-------TTPLADNWQNNKASLGFPNALKTMGVVDGFATRGSSS-DSRFAVGSAFAAGTXXXXXXXXXXXXXXXXXXPK-LRYELPAAS 663
            +SE SA ESV+DNV++ Q A S+V DD     NGS  +E   L+S+ N      P+     GD G       G   P+ KG GL+KWRRI+RD VKD   ++++SK LKRGLSG  +         +P  +  Q ++ S+G  N LK+ G  DGF   GSS  DSRF  G  F+AG                   PK +RYE P  S
Sbjct:    4 ESESSALESVDDNVLIQQSA-SNVCDDGRSLDNGSCSDESVKLLSTSNSVELGKPMSFDSPGDGG-------GAYSPVLKGQGLRKWRRIRRDLVKDTSANMENSKALKRGLSGVAHSHGKQMQFQSPEVE--QESQGSVGSVNMLKSSG--DGFDILGSSGYDSRFVAGVGFSAGMDLEIDDDRSSKSSTVARAPKVIRYEKPMIS 198          
BLAST of FC869289 vs. ExPASy Swiss-Prot
Match: WIP3_ARATH (WPP domain-interacting protein 3 OS=Arabidopsis thaliana GN=WIP3 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.869e-13
Identity = 61/165 (36.97%), Postives = 84/165 (50.91%), Query Frame = 1
Query:   91 SAHESVEDNVVVSQGAVSHVNDDNSVKINGSYVNELVSSDNHDANVAPVDCKETGDQGLAMKSPTGGSPPMKKGYGLKKWRRIKRDF-VKD-AGPSVDSSKILKRGLSGAVNPTT-----PLADNWQNNKASLGFPNALKTMGVVDGFATRGSSSDSRFAVGSAF 564
            S  +SVEDN              NSV  NG  V  L  +D+ +  V       +  +  +++SP G     +KG+GLKKWRRIKRD  V+D A P  D SK+LKRGL+G VNP +        +  Q+++ S+G  N +   GV +GF+         FAVG AF
Sbjct:    4 SVPDSVEDN-------------GNSVPANGLLV--LPDNDHEEGGVG------SPQRSNSVESPGGSVHSTRKGFGLKKWRRIKRDGPVRDEAAPVDDGSKLLKRGLAGLVNPPSKHVEFSSVEARQSSEGSVGSVNMVHHPGVANGFS---PDIGCMFAVGQAF 144          
The following BLAST results are available for this feature:
BLAST of FC869289 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
WIP1_ARATH3.381e-2239.13WPP domain-interacting protein 1 OS=Arabidopsis th... [more]
WIP3_ARATH2.869e-1336.97WPP domain-interacting protein 3 OS=Arabidopsis th... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31010F02EF AbioticL1 Citrus clementina cDNA clone C31010F02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869289 ID=FC869289|Name=FC869289|organism=Citrus clementina|type=EST|length=673bp
GGTTTCCAAATTCTTCGATTTTCGATATATCCTTATTTTGCACTTAAAGA
TTCATTTATGGATCATTAATAGTCACATAAAAGTGAACGTTCAGCTCATG
AATCTGTGGAAGATAATGTAGTAGTGAGCCAAGGAGCTGTATCCCATGTT
AATGATGACAATAGCGTTAAGATTAATGGGTCATATGTCAACGAGTTGGT
TAGTAGTGACAATCATGATGCTAATGTAGCACCAGTTGATTGCAAAGAAA
CGGGTGACCAAGGTTTGGCAATGAAATCTCCAACCGGAGGTTCACCTCCT
ATGAAGAAAGGGTATGGATTAAAGAAATGGAGGCGGATTAAGAGGGATTT
TGTTAAGGATGCTGGTCCTAGTGTGGATAGCAGCAAAATTTTGAAGCGGG
GTTTGTCTGGTGCTGTTAATCCAACTACACCATTGGCTGATAATTGGCAG
AATAACAAGGCTTCTCTTGGATTCCCAAATGCATTAAAAACCATGGGTGT
TGTTGATGGCTTTGCAACTCGTGGCTCTAGTTCGGATTCTAGGTTTGCGG
TTGGTTCCGCTTTTGCTGCGGGTACGGATTCTGAGAACAGTGAGGATCGA
AGTAGCAAGTCTTCTACAGCAGCCAGTGCTCCAAAGTTGAGATATGAATT
GCCTGCTGCATCAGTGTATGTGC
back to top