FC869291

Overview
NameFC869291
Unique NameFC869291
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length739
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9496 contig Ccv1_Contig9496:1..739. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: L14AB_XENLA (Protein LSM14 homolog A-B OS=Xenopus laevis GN=lsm14a-B PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.987e-21
Identity = 63/149 (42.28%), Postives = 86/149 (57.72%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLPSGTGSLPDPTSQTSQLGLSRPPFQGNPPLYQPGGSLGAWGSSPMPTTN 588
            ISL SK+EIRYEG+L+ I+TE S++ L  VRSFGTE R  D P +PP D+++EYI+FRGSDIKDL V   P  Q   S+  DPAI+QS    ++ +S    S  G      + +     S  P  G       G SL ++G+    +T+
Sbjct:   12 ISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-IPPRDEVFEYIIFRGSDIKDLTVCEPPKPQ--CSLPQDPAIVQSSLGSSSASSFQSVSSYGPFGRMPTYSQ---FSTSPLVGQQFGAVAGSSLTSFGAETTSSTS 154          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: L14AA_XENLA (Protein LSM14 homolog A-A OS=Xenopus laevis GN=lsm14a-A PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.390e-21
Identity = 56/105 (53.33%), Postives = 71/105 (67.62%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLPSGTG 456
            ISL SK+EIRYEG+L+ I+TE S++ L  VRSFGTE R  D P +PP D+I+EYI+FRGSDIKDL V   P  Q   S+  DPAI+QS    ++ +S    S  G
Sbjct:   12 ISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-IPPRDEIFEYIIFRGSDIKDLTVCEPPKPQ--CSLPQDPAIVQSSLGSSSASSFQSVSSYG 113          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: LS14A_XENTR (Protein LSM14 homolog A OS=Xenopus tropicalis GN=lsm14a PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.427e-21
Identity = 55/105 (52.38%), Postives = 71/105 (67.62%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLPSGTG 456
            ISL SK+EIRYEG+L+ I+TE S++ L  VRSFGTE R  D P +PP D+++EYI+FRGSDIKDL V   P  Q   S+  DPAI+QS    ++ +S    S  G
Sbjct:   12 ISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-IPPRDEVFEYIIFRGSDIKDLTVCEPPKPQ--CSLPQDPAIVQSSLGSSSASSFQSVSSYG 113          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: SUM2_SCHPO (Protein sum2 OS=Schizosaccharomyces pombe GN=sum2 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.782e-21
Identity = 68/180 (37.78%), Postives = 101/180 (56.11%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQ-VPPSDKIYEYILFRGSDIKDLQVK------SSPPIQTTTSIHNDPAII-----QSHYSQAAIASTTLPSGTGSLPDPTSQTSQLGLSRPPFQGNPPLYQPGGSLGAWGSSPMPTTNGAGL-AMPMYWQGFYGSPN 642
            ISL SKS+IRY G+L +IN+++S++ L++VR  GTEGR++D  Q +PPSD +++YI+FRGSD+KDL+++      S+PP+Q      NDPAII     Q +++QA  A    P        P  Q    G     +   P  + P G L      P+ T   A   A+P     +YG+P+
Sbjct:    9 ISLISKSDIRYVGILQDINSQDSTLALKHVRWCGTEGRKQDPSQEIPPSDNVFDYIVFRGSDVKDLRIEEPATTPSAPPVQPP----NDPAIIGSNSGQYNWNQAQTAQPPQPVQPNPYGAPYQQAPPAGAPYYMYPNAPAQFVPPGGL------PLGTPLDASTPAVP-----YYGAPD 173          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: LS14A_PONAB (Protein LSM14 homolog A OS=Pongo abelii GN=LSM14A PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.551e-21
Identity = 69/153 (45.10%), Postives = 85/153 (55.56%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLPSGTGSLPDPTSQTSQLGLSRPPFQGNPPLY----------QPGGSLGAWGSS 570
            ISL SK+EIRYEG+L+ I+TE S++ L  VRSFGTE R  D P +PP D+++EYI+FRGSDIKDL V   P  Q   S+  DPAI+QS                 SL   TS    +G S  PF G  P Y          Q  G++G  GSS
Sbjct:   12 ISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-IPPRDEVFEYIIFRGSDIKDLTVCEPPKPQ--CSLPQDPAIVQS-----------------SLGSSTSSFQSMG-SYGPF-GRMPTYSQFSPSSLVGQQFGAVGVAGSS 142          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: LS14A_HUMAN (Protein LSM14 homolog A OS=Homo sapiens GN=LSM14A PE=1 SV=3)

HSP 1 Score: 100.908 bits (250), Expect = 7.551e-21
Identity = 69/153 (45.10%), Postives = 85/153 (55.56%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLPSGTGSLPDPTSQTSQLGLSRPPFQGNPPLY----------QPGGSLGAWGSS 570
            ISL SK+EIRYEG+L+ I+TE S++ L  VRSFGTE R  D P +PP D+++EYI+FRGSDIKDL V   P  Q   S+  DPAI+QS                 SL   TS    +G S  PF G  P Y          Q  G++G  GSS
Sbjct:   12 ISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-IPPRDEVFEYIIFRGSDIKDLTVCEPPKPQ--CSLPQDPAIVQS-----------------SLGSSTSSFQSMG-SYGPF-GRMPTYSQFSPSSLVGQQFGAVGVAGSS 142          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: LS14A_BOVIN (Protein LSM14 homolog A OS=Bos taurus GN=LSM14A PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.862e-21
Identity = 69/153 (45.10%), Postives = 85/153 (55.56%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLPSGTGSLPDPTSQTSQLGLSRPPFQGNPPLY----------QPGGSLGAWGSS 570
            ISL SK+EIRYEG+L+ I+TE S++ L  VRSFGTE R  D P +PP D+++EYI+FRGSDIKDL V   P  Q   S+  DPAI+QS                 SL   TS    +G S  PF G  P Y          Q  G++G  GSS
Sbjct:   12 ISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-IPPRDEVFEYIIFRGSDIKDLTVCEPPKPQ--CSLPQDPAIVQS-----------------SLGSSTSSFQSVG-SYGPF-GRMPTYSQFSPSSLVGQQFGAVGVAGSS 142          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: LS14A_MOUSE (Protein LSM14 homolog A OS=Mus musculus GN=Lsm14a PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.682e-20
Identity = 52/88 (59.09%), Postives = 65/88 (73.86%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQS 405
            ISL SK+EIRYEG+L+ I+TE S++ L  VRSFGTE R  D P +PP D+++EYI+FRGSDIKDL V   P  Q   S+  DPAI+QS
Sbjct:   12 ISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-IPPRDEVFEYIIFRGSDIKDLTVCEPPKPQ--CSLPQDPAIVQS 96          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: L14BB_XENLA (Protein LSM14 homolog B-B OS=Xenopus laevis GN=lsm14b-B PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.682e-20
Identity = 51/101 (50.50%), Postives = 70/101 (69.31%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLP 444
            ISL SK++IRYEG+L+ I+TE S++ L  VRSFGTE R  D P  PP +++YEYI+FRGSDIKD+ V   P  + + ++  DPAI+QS    AA    ++P
Sbjct:   12 ISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRP-APPREEVYEYIIFRGSDIKDITVCEPP--KASHALSQDPAIVQSSLGSAASYQPSVP 109          
BLAST of FC869291 vs. ExPASy Swiss-Prot
Match: LS14B_MOUSE (Protein LSM14 homolog B OS=Mus musculus GN=Lsm14b PE=2 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.197e-20
Identity = 60/136 (44.12%), Postives = 78/136 (57.35%), Query Frame = 1
Query:  142 ISLTSKSEIRYEGVLFNINTEESSIGLRNVRSFGTEGRRKDGPQVPPSDKIYEYILFRGSDIKDLQVKSSPPIQTTTSIHNDPAIIQSHYSQAAIASTTLPSGTGSLPDPTSQTSQLGLSRPPFQGNPPLYQPGGS 549
            ISL SK++IRYEG+L+ I+T+ S++ L  VRSFGTE R  D P  PP ++IYEYI+FRGSDIKD+ V   P  Q T  +  DPAI+QS                 SL   ++   Q  +   PF+G PP  Q   S
Sbjct:   14 ISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRP-APPREEIYEYIIFRGSDIKDITVCEPPKAQHT--LPQDPAIVQS-----------------SLGSASASPFQPHVPYSPFRGMPPYGQLAAS 129          
The following BLAST results are available for this feature:
BLAST of FC869291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
L14AB_XENLA1.987e-2142.28Protein LSM14 homolog A-B OS=Xenopus laevis GN=lsm... [more]
L14AA_XENLA3.390e-2153.33Protein LSM14 homolog A-A OS=Xenopus laevis GN=lsm... [more]
LS14A_XENTR4.427e-2152.38Protein LSM14 homolog A OS=Xenopus tropicalis GN=l... [more]
SUM2_SCHPO5.782e-2137.78Protein sum2 OS=Schizosaccharomyces pombe GN=sum2 ... [more]
LS14A_PONAB7.551e-2145.10Protein LSM14 homolog A OS=Pongo abelii GN=LSM14A ... [more]
LS14A_HUMAN7.551e-2145.10Protein LSM14 homolog A OS=Homo sapiens GN=LSM14A ... [more]
LS14A_BOVIN9.862e-2145.10Protein LSM14 homolog A OS=Bos taurus GN=LSM14A PE... [more]
LS14A_MOUSE1.682e-2059.09Protein LSM14 homolog A OS=Mus musculus GN=Lsm14a ... [more]
L14BB_XENLA1.682e-2050.50Protein LSM14 homolog B-B OS=Xenopus laevis GN=lsm... [more]
LS14B_MOUSE2.197e-2044.12Protein LSM14 homolog B OS=Mus musculus GN=Lsm14b ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31010F04EF AbioticL1 Citrus clementina cDNA clone C31010F04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869291 ID=FC869291|Name=FC869291|organism=Citrus clementina|type=EST|length=739bp
GATCATCATCAATTGTCTCGAGGAGTTTGAGAAAAGAAGGGGAAAAAAAG
GCACTCGTCTCAAAGGCTAATGGCAGCGGCGGCAACAGAGGCGCCCAGAT
CTTCTTCAAGTGGGTCTGCTGATTCGTACATCGGTAGCTTGATCAGCTTG
ACTTCCAAGTCTGAGATTCGTTACGAGGGTGTTCTCTTTAACATCAACAC
TGAAGAATCTAGCATCGGTTTGAGAAATGTAAGATCGTTTGGAACAGAAG
GGCGAAGAAAAGATGGTCCCCAGGTTCCACCAAGTGATAAAATTTATGAG
TACATACTCTTTCGAGGAAGTGATATCAAGGATTTGCAGGTCAAATCTTC
CCCACCGATTCAGACTACAACATCTATACACAATGATCCTGCTATTATAC
AGTCGCACTATTCTCAGGCAGCAATTGCATCTACAACCTTGCCTTCTGGT
ACTGGATCATTACCTGATCCAACTTCCCAAACGTCACAGCTAGGACTTTC
CAGACCTCCATTTCAGGGGAATCCTCCCCTTTATCAGCCAGGTGGCAGTT
TGGGTGCATGGGGTTCATCACCCATGCCCACAACAAATGGTGCTGGGCTT
GCCATGCCAATGTACTGGCAAGGATTCTATGGGTCACCGAATGGGCTTCA
GGGCCNAGCAGCACCTTTGCTTCAACCCCCTCCTGGATTGTCAATGCTAC
CGTCCATGCAGCAATCCCATGCATATCCTGCCATGAATC
back to top