FC869294

Overview
NameFC869294
Unique NameFC869294
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length704
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC869294_ssr87 microsatellite FC869294_ssr87:87..98. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9497 contig Ccv1_Contig9497:1..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H29_ARATH (Zinc finger CCCH domain-containing protein 29 OS=Arabidopsis thaliana GN=At2g40140 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.469e-42
Identity = 92/178 (51.69%), Postives = 122/178 (68.54%), Query Frame = 1
Query:  172 SNSKFCSSNFLMEGELPKLK--DGALYNKSSILLELSASDDISAYKREIEEK-GFDVDEPSF*YGRRIGSKKMGFEERTPIMIAAMFGSVAVLKYVIETGKVDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSPLHSRKRAIELLLKGDH 696
            + S  CSS  L E E  + K  DGA    ++ LLE +A DD+S++KREIEE    ++DE  F Y RR+GSKKMGFEERTP+M+AAM+GS+ VL Y+I TG+ DVNR C  +  TALHCAV+G + S  E++K+LL ASA  NCVDA GNK VDL+    +   +  ++A+E+LL G H
Sbjct:    4 AKSNLCSSKTLTEVEFMRQKSEDGA---SATCLLEFAACDDLSSFKREIEENPSVEIDESGFWYCRRVGSKKMGFEERTPLMVAAMYGSMEVLNYIIATGRSDVNRVCSDEKVTALHCAVSGCSVSIVEIIKILLDASASPNCVDANGNKPVDLLAKDSRFVPNQSRKAVEVLLTGIH 178          
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H47_ARATH (Zinc finger CCCH domain-containing protein 47 OS=Arabidopsis thaliana GN=At3g55980 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.759e-40
Identity = 85/171 (49.71%), Postives = 118/171 (69.01%), Query Frame = 1
Query:  178 SKFCSSNFLMEGELPKLKDGALYNKSSILLELSASDDISAYKREIEEKGFDVDEPSF*YGRRIGSKKMGFEERTPIMIAAMFGSVAVLKYVIETGKVDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSPLHSRKRAIELLLKG 690
            S  CSS  L E E  + ++     ++ +LLE +A DD+ ++KRE+EEKG D+DE    Y RR+GSKKMG EERTP+M+AAM+GS+ VL +++ TGK DVNRACG +  T LHCAVAG + +  EV+ +LL ASA VN VDA GN+ +D+     +     R++A+ELLL+G
Sbjct:    7 SNLCSSRTLTEIESRQKEE-----ETMLLLEFAACDDLDSFKREVEEKGLDLDESGLWYCRRVGSKKMGLEERTPLMVAAMYGSIKVLTFIVSTGKSDVNRACGEERVTPLHCAVAGCSVNMIEVINVLLDASALVNSVDANGNQPLDVFVRVSRFVASPRRKAVELLLRG 172          
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H66_ARATH (Zinc finger CCCH domain-containing protein 66 OS=Arabidopsis thaliana GN=At5g58620 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.669e-38
Identity = 82/149 (55.03%), Postives = 108/149 (72.48%), Query Frame = 1
Query:  250 KSSILLELSASDDISAYKREIEEKGFD-VDEPSF*YGRRIGSKKMGFEERTPIMIAAMFGSVAVLKYVIETGKVDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSPLHSRKRAIELLLKGD 693
            K S+LLE SA +D+S +K  +EE+G + +D     YGRR+GSKKMGFEERTP+MIAA+FGS  V+ Y+I TG VDVNR+CGSDG TALHCAV+G + +S E+V LLL  SA+ +  DAYGNK  D+I   +     +R + +E LLKG+
Sbjct:   10 KFSLLLESSACNDLSGFKSLVEEEGLESIDGSGLWYGRRLGSKKMGFEERTPLMIAALFGSKEVVDYIISTGLVDVNRSCGSDGATALHCAVSGLSANSLEIVTLLLKGSANPDSCDAYGNKPGDVIFPCLSPVFSARMKVLERLLKGN 158          
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H30_ARATH (Zinc finger CCCH domain-containing protein 30 OS=Arabidopsis thaliana GN=At2g41900 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 4.970e-27
Identity = 66/144 (45.83%), Postives = 92/144 (63.89%), Query Frame = 1
Query:  262 LLELSASDDISAYKREIEEKGFDVDEPSF*YGRRIGSKKMGFEERTPIMIAAMFGSVAVLKYVIETGKVDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSPLHSRKRAIELLLKGD 693
            LLEL+A++D+   +  IE     VDE    YGR+ GSK M  + RTP+M+AA +GS+ V+K ++     DVNRACG+D  TALHCA +GG  ++ +VVKLLL+A AD+N +DA G +  D+I V  K  L   K  ++ LL  D
Sbjct:   48 LLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGSKAMVNDYRTPLMVAATYGSIDVIKLIVSLTDADVNRACGNDQTTALHCAASGGAVNAIQVVKLLLAAGADLNLLDAEGQRAGDVIVVPPK--LEGVKLMLQELLSAD 189          
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H24_ORYSJ (Zinc finger CCCH domain-containing protein 24 OS=Oryza sativa subsp. japonica GN=Os03g0698800 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.496e-23
Identity = 66/142 (46.48%), Postives = 85/142 (59.86%), Query Frame = 1
Query:  262 LLELSASDDISAYKREIEEKG-FDVDEPSF*YGRRIGSKKMGFEERTPIMIAAMFGSVAVLKYVIETGKVDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSPLHSRKRAIELLL 684
            LLEL+A DD    +R +E       DE    YGRR        E RTP+M+AA +GS+AVL+ ++    VDVNR CGSDG TALHCA +GG+ S  E VKLLL+A AD +  DA G +  D+I V  K  +   K A++ LL
Sbjct:   70 LLELAADDDAEGLRRALERAPPAAADEAGLWYGRR-----KVLEHRTPLMVAATYGSLAVLRLLLSLPSVDVNRRCGSDGTTALHCAASGGSPSCVEAVKLLLAAGADADATDASGYRPADVISVPPK--MFDAKIALQDLL 204          
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H56_ARATH (Zinc finger CCCH domain-containing protein 56 OS=Arabidopsis thaliana GN=At5g12850 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.954e-23
Identity = 58/160 (36.25%), Postives = 102/160 (63.75%), Query Frame = 1
Query:  226 LKDGALYNKS-SILLELSASDDISAYKREIEEKGFDVDEPSF*YGRRIGSKKMGFEERTPIMIAAMFGSVAVLKYVIETGKVDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSPLHSRKRAIELLLKGDHTI 702
            + D A +  S S LLE +A +D+  ++R++ +    +++    Y R+   ++M  E+RTP+M+A+++GS+ V+K+++   + ++N +CG D  TALHCA +G + +S +VVKLLLS  AD N  DA+GN+ VD++ V+  +P    +  +E +LK D  I
Sbjct:   29 MNDAAEWEHSFSALLEFAADNDVEGFRRQLSDVSC-INQMGLWYRRQRFVRRMVLEQRTPLMVASLYGSLDVVKFILSFPEAELNLSCGPDKSTALHCAASGASVNSLDVVKLLLSVGADPNIPDAHGNRPVDVLVVSPHAP--GLRTILEEILKKDEII 185          
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H33_ORYSJ (Zinc finger CCCH domain-containing protein 33 OS=Oryza sativa subsp. japonica GN=Os05g0128200 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.322e-21
Identity = 60/158 (37.97%), Postives = 91/158 (57.59%), Query Frame = 1
Query:  217 LPKLKDGALYNKSSILLELSASDDISAYKREIEEKGFDVDEPSF*YGRRI-GSKKMGFEERTPIMIAAMFGSVAVLKYVIETGKVDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSPLHSRKRAIELLLK 687
            LP+ +  A    +S+LLEL+A+DD++A +R +EE+   +      YG    G  ++G E RT  M+AA++GS  VL YV+     +  RA  +DG T LH A AGG  ++    +LLL+A A V+ + A G +  DL+P A      + ++AI LLLK
Sbjct:   13 LPQQQKEATVMAASLLLELAAADDVAAVRRVVEEEKVSLGVAGLWYGPSASGVARLGMERRTAAMVAALYGSTGVLGYVVAAAPAEAARASETDGATPLHMAAAGGAANAVAATRLLLAAGASVDALSASGLRAGDLLPRAT-----AAEKAIRLLLK 165          
BLAST of FC869294 vs. ExPASy Swiss-Prot
Match: C3H50_ORYSJ (Zinc finger CCCH domain-containing protein 50 OS=Oryza sativa subsp. japonica GN=Os07g0568300 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.110e-18
Identity = 56/139 (40.29%), Postives = 82/139 (58.99%), Query Frame = 1
Query:  235 GALYNKSSILLELSASDDISAYKREIEEKGFDVDEPSF*YGRRIGSKKMGFEERTPIMIAAMFGSVAVLKYVIETGK-VDVNRACGSDGFTALHCAVAGGTKSSFEVVKLLLSASADVNCVDAYGNKLVDLIPVAMKSP 648
            G   ++ + LLEL+A+DD+   +  + E G +  E +   G   G  K  +E RTP+M+AA +GS  V+  ++  G  VDVNR  G+DG TALHCA +GG++++  VVKLLL+A AD    D+ G    D+I     SP
Sbjct:   18 GGRRDRLAALLELAAADDVDGLRGALAEGGEEAAELADGVGLWYGRSK-AYEARTPLMVAATYGSAGVVSLLVGLGGCVDVNRRPGADGATALHCAASGGSRNAVAVVKLLLAAGADPATPDSAGRFPADVILAPPASP 155          
The following BLAST results are available for this feature:
BLAST of FC869294 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
C3H29_ARATH5.469e-4251.69Zinc finger CCCH domain-containing protein 29 OS=A... [more]
C3H47_ARATH1.759e-4049.71Zinc finger CCCH domain-containing protein 47 OS=A... [more]
C3H66_ARATH3.669e-3855.03Zinc finger CCCH domain-containing protein 66 OS=A... [more]
C3H30_ARATH4.970e-2745.83Zinc finger CCCH domain-containing protein 30 OS=A... [more]
C3H24_ORYSJ1.496e-2346.48Zinc finger CCCH domain-containing protein 24 OS=O... [more]
C3H56_ARATH1.954e-2336.25Zinc finger CCCH domain-containing protein 56 OS=A... [more]
C3H33_ORYSJ5.322e-2137.97Zinc finger CCCH domain-containing protein 33 OS=O... [more]
C3H50_ORYSJ1.110e-1840.29Zinc finger CCCH domain-containing protein 50 OS=O... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31010F07EF AbioticL1 Citrus clementina cDNA clone C31010F07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869294 ID=FC869294|Name=FC869294|organism=Citrus clementina|type=EST|length=704bp
GAAAGAAACACATAAAAAGGCTCTCACCCCCCTTACCTTAGTCTCTCACT
TCACACAAGTCATTTCTCAAAAGCTGAGTCTTTTTGTTCTTCTTCTTCTA
TAAAATTAACACTCTTAAAGAATCAAAGAATCTTATCAACTTATCAAGCT
CTACTTATAGGAATTGGGTATTCAAATAGTAAATTTTGCAGCTCAAATTT
CCTCATGGAAGGTGAACTCCCCAAGCTGAAAGATGGTGCCTTGTATAACA
AATCCTCAATTTTGCTGGAATTGTCAGCTTCTGACGATATCTCTGCCTAT
AAGAGAGAAATAGAAGAGAAGGGTTTTGATGTTGATGAGCCCAGCTTCTG
ATATGGTAGGAGAATTGGGTCAAAAAAGATGGGATTTGAAGAGAGGACCC
CAATCATGATTGCTGCCATGTTTGGAAGTGTTGCGGTATTGAAATATGTT
ATTGAAACAGGCAAAGTTGATGTGAATAGGGCCTGTGGATCTGATGGTTT
CACTGCCCTTCACTGTGCTGTTGCTGGTGGTACCAAATCTTCCTTTGAGG
TGGTCAAGCTCTTACTCAGTGCATCTGCTGATGTTAACTGTGTTGATGCG
TATGGGAATAAGCTAGTCGATCTCATTCCAGTTGCTATGAAATCACCACT
CCATTCAAGAAAAAGGGCAATAGAGTTATTGTTGAAAGGCGATCATACTA
TTTT
back to top