FC869300

Overview
NameFC869300
Unique NameFC869300
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length686
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9499 contig Ccv1_Contig9499:1..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: CP20C_ARATH (Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic OS=Arabidopsis thaliana GN=CYP20-3 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.975e-41
Identity = 101/197 (51.27%), Postives = 126/197 (63.96%), Query Frame = 3
Query:  111 MASTVSTQMRLHSPALIFQGSYSQGVANVCMLPMTSSITNSQSGHCPASTLKLSGRALTSRSHYASSFPIVQLSKA-PSVKYRRMFCVNSMAKD----VELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            MAS+ S QM +H+         S+ +A +     +  ++ +++        + SG AL+SR HYAS  PI Q S    + K++R  CV SMA +    +E QAKVT KV+FDV+IGG+ AGRIVMGLFG+VVPKT ENFRALCTGEK YGYKG SFHRIIKDFMIQ            ISIYG+ FEDE+F LKH G
Sbjct:    1 MASSSSMQM-VHT---------SRSIAQIGFGVKSQLVSANRTTQSVCFGARSSGIALSSRLHYAS--PIKQFSGVYATTKHQRTACVKSMAAEEEEVIEPQAKVTNKVYFDVEIGGEVAGRIVMGLFGEVVPKTVENFRALCTGEKKYGYKGSSFHRIIKDFMIQGGDFTEGNGTGGISIYGAKFEDENFTLKHTG 185          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: CYPB_VICFA (Peptidyl-prolyl cis-trans isomerase, chloroplastic OS=Vicia faba PE=1 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 3.855e-37
Identity = 79/136 (58.09%), Postives = 95/136 (69.85%), Query Frame = 3
Query:  282 LTSRSHYASSFPIVQLSKAPSVKYRRMFCVNSMAKDV-ELQAKVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            L+S  HYA    + Q SKA S+  RR+ C +    +V ELQAKVT+K+FFD++IGG+ AGRIV+GLFGD VPKT ENF+ L TG KGYGY+G  FHRII +FMIQ            +SIYGS FEDESF LKHVG
Sbjct:   37 LSSTYHYAPRLSVSQQSKAKSITSRRITCASGAQGEVAELQAKVTSKIFFDIEIGGESAGRIVIGLFGDAVPKTVENFKTLSTGAKGYGYQGSFFHRIIPNFMIQGGDFTEGNGTGGVSIYGSKFEDESFDLKHVG 172          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: CP20B_ARATH (Peptidyl-prolyl cis-trans isomerase CYP20-2, chloroplastic OS=Arabidopsis thaliana GN=CYP20-2 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.864e-29
Identity = 79/183 (43.17%), Postives = 106/183 (57.92%), Query Frame = 3
Query:  201 MLPMTSSITNSQSGHCPASTLK-LSGRALTSRSH------------YASSFPIVQLSKAPSVKY----RRMFCVNSMAKDV-ELQAKVTTKVFFDVDIG---GKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            M  ++ +++N +S   P   L  ++  A TS S             ++SS P    S      Y     R F V S A+ V E Q+K+T KV+FD+ +G   GK AGRIV+GL+GD VP+T ENFRALCTGEKG+GYKG +FHR+I+DFMIQ             S+YG +F+DE+F L HVG
Sbjct:    1 MATLSMTLSNPKSLSAPPRRLSPINTSAFTSTSFRLRTKSSFDSISFSSSTPFSASSLLLHTSYTKRNHRCFSVQSNAEVVTEPQSKITHKVYFDISVGNPVGKLAGRIVIGLYGDDVPQTVENFRALCTGEKGFGYKGSTFHRVIRDFMIQGGDFEKGNGTGGKSVYGRTFKDENFKLSHVG 183          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: PPIC_BOVIN (Peptidyl-prolyl cis-trans isomerase C OS=Bos taurus GN=PPIC PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 7.287e-28
Identity = 62/93 (66.67%), Postives = 66/93 (70.97%), Query Frame = 3
Query:  408 VTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            VT KVFFDV IG K  GRIV+GLFG VVPKT ENF AL TGEKGYGYKG  FHR+IKDFMIQ            ISIYG +F DE+F LKH G
Sbjct:   36 VTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDFTRGDGTGGISIYGETFPDENFKLKHYG 128          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: PPIC_HUMAN (Peptidyl-prolyl cis-trans isomerase C OS=Homo sapiens GN=PPIC PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.517e-28
Identity = 61/93 (65.59%), Postives = 66/93 (70.97%), Query Frame = 3
Query:  408 VTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            VT KVFFDV IG K  GRIV+GLFG VVPKT ENF AL TGEKGYGYKG  FHR+IKDFMIQ            +SIYG +F DE+F LKH G
Sbjct:   36 VTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYG 128          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: PPIC_MOUSE (Peptidyl-prolyl cis-trans isomerase C OS=Mus musculus GN=Ppic PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.120e-27
Identity = 61/93 (65.59%), Postives = 67/93 (72.04%), Query Frame = 3
Query:  408 VTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            VT KVFFDV IG K  GRIV+GLFG+VVPKT ENF AL TGEKGYGYKG  FHR+IKDFMIQ            +SIYG +F DE+F LKH G
Sbjct:   36 VTDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFVALATGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYG 128          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: PPIB_ARTBE (Peptidyl-prolyl cis-trans isomerase B OS=Arthroderma benhamiae GN=CPR2 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.120e-27
Identity = 59/102 (57.84%), Postives = 75/102 (73.53%), Query Frame = 3
Query:  378 MAKDVELQA-KVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKH 680
            M + VE +  K+T+KV+FD++  G+P GRIVMGL+G  VPKTAENFRAL TGEKG+GY+G +FHR+IKDFMIQ             SIYG+ FEDE+F L+H
Sbjct:   22 MGQTVEAKGPKITSKVYFDIEHDGQPLGRIVMGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRVIKDFMIQGGDFTNGDGTGGKSIYGNKFEDENFKLRH 123          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: PPIB_ASPNG (Peptidyl-prolyl cis-trans isomerase B OS=Aspergillus niger GN=cypB PE=3 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.052e-26
Identity = 55/92 (59.78%), Postives = 68/92 (73.91%), Query Frame = 3
Query:  405 KVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKH 680
            K+T+KVFFD++ G KP GR+V+GL+G  VPKTAENFRAL TGEKG+GY+G +FHR+IKDFMIQ             SIYG  F DE+F L+H
Sbjct:   32 KITSKVFFDIEHGDKPLGRVVLGLYGKTVPKTAENFRALATGEKGFGYEGSTFHRVIKDFMIQGGDFTRGDGTGGKSIYGEKFADENFKLRH 123          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: PPIA1_RHIOR (Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus oryzae GN=cyp2 PE=3 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.052e-26
Identity = 57/90 (63.33%), Postives = 64/90 (71.11%), Query Frame = 3
Query:  417 KVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            KVFFDV    KP GRIVM L  DVVP+TAENFRALCTGEKG+GYKGCSFHR+I +FM+Q             SIYG+ F DE+F LKH G
Sbjct:    5 KVFFDVSANSKPLGRIVMELRADVVPQTAENFRALCTGEKGFGYKGCSFHRVIPEFMLQGGDFTNHNGTGGKSIYGNKFRDENFTLKHTG 94          
BLAST of FC869300 vs. ExPASy Swiss-Prot
Match: PPIB_ORPSP (Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyces sp. (strain PC-2) GN=CYPB PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.062e-26
Identity = 57/94 (60.64%), Postives = 65/94 (69.15%), Query Frame = 3
Query:  405 KVTTKVFFDVDIGGKPAGRIVMGLFGDVVPKTAENFRALCTGEKGYGYKGCSFHRIIKDFMIQXXXXXXXXXXXXISIYGSSFEDESFVLKHVG 686
            KVT KV+FD+  G K  GRIV+GL+G+VVPKT ENFRAL TGEKGYGYK   FHR+IKDFMIQ             SIYG  F DE+F L+H G
Sbjct:   27 KVTNKVYFDIKQGDKDLGRIVLGLYGEVVPKTVENFRALATGEKGYGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFADENFKLRHTG 120          
The following BLAST results are available for this feature:
BLAST of FC869300 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 157
Match NameE-valueIdentityDescription
CP20C_ARATH1.975e-4151.27Peptidyl-prolyl cis-trans isomerase CYP20-3, chlor... [more]
CYPB_VICFA3.855e-3758.09Peptidyl-prolyl cis-trans isomerase, chloroplastic... [more]
CP20B_ARATH3.864e-2943.17Peptidyl-prolyl cis-trans isomerase CYP20-2, chlor... [more]
PPIC_BOVIN7.287e-2866.67Peptidyl-prolyl cis-trans isomerase C OS=Bos tauru... [more]
PPIC_HUMAN9.517e-2865.59Peptidyl-prolyl cis-trans isomerase C OS=Homo sapi... [more]
PPIC_MOUSE2.120e-2765.59Peptidyl-prolyl cis-trans isomerase C OS=Mus muscu... [more]
PPIB_ARTBE2.120e-2757.84Peptidyl-prolyl cis-trans isomerase B OS=Arthroder... [more]
PPIB_ASPNG1.052e-2659.78Peptidyl-prolyl cis-trans isomerase B OS=Aspergill... [more]
PPIA1_RHIOR1.052e-2663.33Peptidyl-prolyl cis-trans isomerase A1 OS=Rhizopus... [more]
PPIB_ORPSP3.062e-2660.64Peptidyl-prolyl cis-trans isomerase B OS=Orpinomyc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31010G01EF AbioticL1 Citrus clementina cDNA clone C31010G01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869300 ID=FC869300|Name=FC869300|organism=Citrus clementina|type=EST|length=686bp
TACAAAATCAAAAGGTCTTCCAACCTAATAGAAGCTTCTTATTAGTTATC
ACTGGCTGCAGGCTCCAGCTGCGGCAAATTTGGGCGACCCCTATTACCTA
ATCCATTGTTATGGCTTCTACTGTCTCTACTCAGATGCGGCTGCATAGCC
CCGCCCTCATTTTCCAGGGCAGTTATAGCCAAGGTGTTGCAAATGTTTGT
ATGCTACCTATGACGTCTAGCATTACAAATTCGCAGTCAGGTCATTGCCC
AGCTTCTACTTTGAAGTTGTCTGGAAGAGCATTGACATCAAGATCCCACT
ATGCATCAAGCTTTCCCATCGTACAGCTTTCTAAAGCACCTTCTGTTAAG
TATCGAAGAATGTTCTGTGTCAACTCAATGGCAAAGGATGTAGAGCTGCA
AGCAAAAGTGACAACCAAAGTTTTCTTTGACGTAGATATTGGAGGTAAAC
CTGCAGGTAGAATAGTAATGGGCCTTTTTGGAGATGTTGTTCCGAAAACA
GCTGAGAACTTTCGTGCACTGTGTACAGGTGAGAAAGGATATGGTTACAA
AGGATGCTCCTTCCACCGTATTATTAAAGATTTTATGATCCAGGGAGGGG
ACTTCACTGAGGGAGATGGAACTGGAGGCATCAGTATTTATGGTTCCAGC
TTTGAAGATGAGAGCTTTGTCTTGAAGCATGTTGGA
back to top