FC869302

Overview
NameFC869302
Unique NameFC869302
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig789 contig Ccv1_Contig789:127..840. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 425.246 bits (1092), Expect = 1.629e-118
Identity = 207/209 (99.04%), Postives = 209/209 (100.00%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 3.629e-118
Identity = 207/209 (99.04%), Postives = 209/209 (100.00%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EIVKEVSSYLKKVGYNP+KVPFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 6.189e-118
Identity = 206/209 (98.56%), Postives = 208/209 (99.52%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 1.056e-117
Identity = 206/209 (98.56%), Postives = 208/209 (99.52%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 1.379e-117
Identity = 205/209 (98.09%), Postives = 208/209 (99.52%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.801e-117
Identity = 206/209 (98.56%), Postives = 208/209 (99.52%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+ FVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 421.009 bits (1081), Expect = 3.072e-117
Identity = 205/209 (98.09%), Postives = 208/209 (99.52%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 420.239 bits (1079), Expect = 5.240e-117
Identity = 204/209 (97.61%), Postives = 208/209 (99.52%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 1.525e-116
Identity = 203/209 (97.13%), Postives = 207/209 (99.04%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLD 209          
BLAST of FC869302 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 3.396e-116
Identity = 204/209 (97.61%), Postives = 205/209 (98.09%), Query Frame = 3
Query:   87 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLD 713
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEK+ FVPISGFEGDNMIERSTNLD
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIERSTNLD 209          
The following BLAST results are available for this feature:
BLAST of FC869302 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ1.629e-11899.04Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_WHEAT3.629e-11899.04Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_MANES6.189e-11898.56Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_TOBAC1.056e-11798.56Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_ARATH1.379e-11798.09Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_MAIZE1.801e-11798.56Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_SOLLC3.072e-11798.09Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_SOYBN5.240e-11797.61Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_VICFA1.525e-11697.13Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A1_DAUCA3.396e-11697.61Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31010G03EF AbioticL1 Citrus clementina cDNA clone C31010G03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869302 ID=FC869302|Name=FC869302|organism=Citrus clementina|type=EST|length=714bp
ATACACTCTCCCAATTTCCGAAGGGCGGCGAGAGAGAACCATTTTCGCGA
ATATCATTTTAATAAGGTTTTTTCTAGATTTGCCTAATGGGTAAGGAGAA
GACTCACATCAACATTGTGGTCATCGGCCATGTCGACTCTGGAAAGTCGA
CCACCACCGGACACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTG
ATCGAGAGGTTCGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAA
ATACGCCTGGGTGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTA
CCATTGATATTGCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACC
GTCATTGATGCTCCCGGACATCGTGACTTTATCAAGAACATGATTACCGG
TACCTCACAGGCTGACTGTGCCGTCCTCATCATTGACTCCACCACCGGTG
GTTTTGAAGCTGGTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTG
CTTGCTTTCACCCTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGAT
GGACGCCACCACCCCCAAGTATTCAAAGGCTAGGTACGATGAAATTGTGA
AGGAGGTCTCTTCCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTC
CCATTCGTGCCCATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTC
TACCAACCTTGACT
back to top