FC869309

Overview
NameFC869309
Unique NameFC869309
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length685
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig13737 contig Ccv1_Contig13737:26..710. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869309 vs. ExPASy Swiss-Prot
Match: MUG70_SCHPO (Meiotically up-regulated gene 70 protein OS=Schizosaccharomyces pombe GN=mug70 PE=1 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.199e-16
Identity = 44/106 (41.51%), Postives = 69/106 (65.09%), Query Frame = 1
Query:  343 TVKKLRLSKALTIPEGTIVSDACRRMASRRVDAVLLTDANALLSGIVTDKDITTRVIAEGLRPDQTVVSKIMTRNPIFVTSDSLAIEALQKMVQGKFRHLPVVENG 660
            TV    L  ALT+   ++V++  + MA++R + VL+ D +  L+GIVT  DI TR +  GL   QT+++ IM+ +P+ +TSD+   +AL  M++ KFRHLPVV +G
Sbjct:   64 TVDSAALDPALTVHMQSLVTETAQLMAAKRQNCVLVVDDDEQLAGIVTATDIATRCVGAGLNARQTLIADIMSTSPLCITSDTRFDDALLLMIEHKFRHLPVVSDG 169          
The following BLAST results are available for this feature:
BLAST of FC869309 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MUG70_SCHPO2.199e-1641.51Meiotically up-regulated gene 70 protein OS=Schizo... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31010G11EF AbioticL1 Citrus clementina cDNA clone C31010G11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869309 ID=FC869309|Name=FC869309|organism=Citrus clementina|type=EST|length=685bp
AAAGAGGGATTTTTCTCTTTCATTACCACGCCCGAGACCGAGAGGAGGCC
TCAAGCGTTATCCGCCAAAAATAGCGGCTAAATAAACCCTAACCCCTCCA
GGCCTCTAGAGAAAACCAAATCATCAAAATCATTTTTCTTCTTCTAGGTT
TTCTTTCTTTTGTTGAAATAATTAAAAAAAAAAGAGAAAATGAGTAGTCA
AGGGGGTAGTCGAAGGAGCCAGAAGAGAGCGCCATCCACGTCCAAAAGGA
CGTCGTCGTCCGAAAATGGAGGAAATCTGTCGAAGCCTCCTTCTCCACAG
GGCGAATCGTCGTCGTCTGTTGGCGGGGCCGGCGGGGAGAGGACGGTGAA
GAAGTTGAGGCTGTCGAAAGCTCTCACAATTCCGGAGGGAACAATTGTGT
CGGATGCTTGCAGGAGAATGGCATCTCGTCGTGTGGATGCGGTTTTGTTG
ACTGATGCTAATGCTTTGCTCTCTGGTATTGTCACGGACAAGGATATTAC
CACCAGGGTTATAGCCGAAGGTTTGAGACCTGATCAGACAGTCGTTTCTA
AGATCATGACCCGCAATCCTATCTTTGTCACTTCTGATTCTTTGGCCATT
GAAGCGCTTCAGAAGATGGTACAAGGAAAGTTCAGGCATCTCCCTGTTGT
AGAGAATGGTGAAGTTATTGCCATTTTGGATATCA
back to top