FC869310

Overview
NameFC869310
Unique NameFC869310
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length581
Libraries
Library NameType
AbioticL1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8357 contig Ccv1_Contig8357:404..984. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 5.347e-73
Identity = 124/162 (76.54%), Postives = 139/162 (85.80%), Query Frame = 2
Query:   95 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPCSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP 580
            QK+ S+ GATKASF            A  G+RSV+VSA AADP+RPLWFP STPPEWLDGSLPGDFGFDPLGLGSDPE+L+WN Q+E+VH RWAMLGAAGIFIPE LTK+G+LNTPSWYTAGE EYFTDTTTLF++E++ IGWAEGRRWADIIKPGCVNTDP
Sbjct:   21 QKNGSIVGATKASFLGGKRLRVSKFIAPVGSRSVAVSAVAADPDRPLWFPGSTPPEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDP 182          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 2.103e-69
Identity = 120/162 (74.07%), Postives = 132/162 (81.48%), Query Frame = 2
Query:   95 QKSRSVAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPCSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP 580
            +++ S+ G TKASF             T   RS +    AADP+RPLWFP STPP WLDGSLPGDFGFDPLGL SDPE+LRWN Q+E+VHCRWAMLGAAGIFIPELLTK+GILNTPSWYTAGE EYFTDTTTLFIVE++ IGWAEGRRWADIIKPGCVNTDP
Sbjct:   21 RRNGSIVGTTKASFLGGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDP 182          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.986e-35
Identity = 66/115 (57.39%), Postives = 81/115 (70.43%), Query Frame = 2
Query:  236 WFPCSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP 580
            W P    P +L GSLPGD GFDPLGL  DPE LRW VQ+E+V+ RWAMLG AG+ +PE+ T +GI+N P WY AG+ EYF  ++TLF++E I   + E RRW DI  PG VN DP
Sbjct:   56 WLPGLASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDP 170          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 1.986e-35
Identity = 66/130 (50.77%), Postives = 87/130 (66.92%), Query Frame = 2
Query:  191 SVSVSAAAADPNRPLWFPCSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP 580
            S   S+   +  +  W P    P++L GSL GD GFDPLGL  DPE L+W VQ+E+V+ RWAMLG AG+ +PE+ TK+GI+N P WY AG+ +YF  ++TLF++E I   + E RRW DI  PG VN DP
Sbjct:   42 SAKTSSFKVEAKKGEWLPGLASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDP 171          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.525e-27
Identity = 65/132 (49.24%), Postives = 80/132 (60.61%), Query Frame = 2
Query:  188 RSVSVSAAAADPNRPLWFPCSTPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWY-TAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPGCVNTDP 580
            R V+V A  +      W P    P +LDGSL GD GFDPL L  DPE LRW VQ+++V+ RWAMLG AG+ IPE+LTK G++N P W    G+  YF  ++T   V M    + E RRW DI  PG VN DP
Sbjct:   26 RDVAVQAKGS------WLPGLQSPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSST-YVEIRRWQDIKNPGSVNQDP 150          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 8.657e-23
Identity = 64/147 (43.54%), Postives = 83/147 (56.46%), Query Frame = 2
Query:  185 TRSVSVSAAAADP------NRPLWFPCSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWY------TAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPG 562
            +R   V AAA  P      +RPLWF       +LDGSLPGD+GFDPLGL SDPE        RW    E+++ R+AMLGA G   PE L K+G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D  KPG
Sbjct:   35 SRKGLVRAAATPPVKQGGVDRPLWFASKQSLSYLDGSLPGDYGFDPLGL-SDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPG 180          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.928e-22
Identity = 60/160 (37.50%), Postives = 83/160 (51.88%), Query Frame = 2
Query:  110 VAGATKASFXXXXXXXXXXXXATAGTRSVSVSAAAADPNRPLWFPCST------PPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA----GELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKP 559
            ++G  K+S              +  +R + V AAAA P +  W P          PEWLDGSLPGDFGFDPLGLG DP  L+W  ++E++H RWAML   GIF+ +  T +       W+ A    G +  F+   TL   +++ +GW E +RW D   P
Sbjct:   19 LSGGKKSSQSLLFVNSKVGAGVSTTSRKLVVVAAAAAPKKS-WIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGI------PWFEAGADPGAVAPFS-FGTLLGTQLLLMGWVESKRWVDFFDP 170          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.519e-22
Identity = 60/140 (42.86%), Postives = 78/140 (55.71%), Query Frame = 2
Query:  188 RSVSVSAAAADPNRPLWFPCSTPPEWLDGSLPGDFGFDPLGLGSDPETL------RWNVQSEIVHCRWAMLGAAGIFIPELLTKLGIL---NTPSWY------TAGELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKPG 562
            R+ S        NR LWF       +LDG LPGDFGFDPLGL SDPE        +W    E+++ R+AMLGAAG   PE+L K G++      +W+       AG   Y+ D  TLF++EM  +G+AE RR+ D  KPG
Sbjct:   40 RAASTPPVKQGANRQLWFASKQSLSYLDGRLPGDFGFDPLGL-SDPEGTGGFIEPKWLAYGEVINGRFAMLGAAGAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPG 178          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 5.252e-20
Identity = 54/137 (39.42%), Postives = 74/137 (54.01%), Query Frame = 2
Query:  179 AGTRSVSVSAAAADPNRPLWFPCS------TPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA----GELEYFTDTTTLFIVEMIFIGWAEGRRWADIIKP 559
            A  +  +V AAAA  +   W P          PEWLDGSLPGD+GFDPLGLG DP  L+W  ++E++H RWAM    GIF+ +  + +       W+ A    G +  F+   TL   ++I +GW E +RW D   P
Sbjct:   39 ATPKRFTVLAAAAKKS---WIPAVRGGGNLVDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGI------PWFEAGADPGAIAPFS-FGTLLGTQLILMGWVESKRWVDFFDP 165          
BLAST of FC869310 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.170e-19
Identity = 51/126 (40.48%), Postives = 71/126 (56.35%), Query Frame = 2
Query:  200 VSAAAADPNRPLWFPCS------TPPEWLDGSLPGDFGFDPLGLGSDPETLRWNVQSEIVHCRWAMLGAAGIFIPELLTKLGILNTPSWYTA----GELEYFTDTTTLFIVEMIFIGWAEGRRWAD 547
            V+AAA  P +  W P          PEWLDGSLPGDFGFDPLGLG DP  L+W  ++E++H RWAM    GIF+ +  + +       W+ A    G +  F+   +L   +++ +GW E +RW D
Sbjct:   44 VAAAAVAPKKS-WIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGI------PWFEAGADPGAIAPFS-FGSLLGTQLLLMGWVESKRWVD 161          
The following BLAST results are available for this feature:
BLAST of FC869310 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
CB12_PETHY5.347e-7376.54Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC2.103e-6974.07Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA1.986e-3557.39Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB24_ARATH1.986e-3550.77Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB120_HORVU1.525e-2749.24Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB23_PEA8.657e-2343.54Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB4_SPIOL1.928e-2237.50Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB13_SOLLC2.519e-2242.86Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB4A_SOLLC5.252e-2039.42Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC1.170e-1940.48Chlorophyll a-b binding protein CP24 10B, chloropl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31010G12EF AbioticL1 Citrus clementina cDNA clone C31010G12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC869310 ID=FC869310|Name=FC869310|organism=Citrus clementina|type=EST|length=581bp
CAGTCATAATTTTGCTGAAAGCCTTTGCCTGGTAGTATTTCCCGCTTCCG
TTTGTGCTTCCCCTGCCGTTGCAGCCATCTCATCCCCCAGTTCTCAGAAG
AGTAGATCAGTTGCGGGAGCAACAAAGGCTTCTTTCCTTGGTGGGAAGAA
GCTGAAATTGAGAAAAAACGGAGCAACAGCGGGAACACGATCGGTTTCAG
TGAGTGCGGCTGCAGCTGATCCTAACAGGCCTCTCTGGTTCCCATGCAGC
ACTCCTCCTGAATGGCTCGATGGTAGCCTCCCCGGAGACTTCGGCTTCGA
TCCTCTTGGTCTTGGATCTGATCCTGAGACGCTGAGATGGAACGTGCAAT
CAGAAATTGTGCACTGCAGATGGGCAATGTTAGGAGCTGCAGGAATTTTC
ATTCCGGAATTGTTAACAAAACTTGGAATCCTCAACACTCCATCCTGGTA
CACAGCTGGGGAGCTAGAGTACTTCACAGACACCACCACCCTGTTCATTG
TTGAGATGATATTCATAGGCTGGGCAGAGGGCAGACGGTGGGCCGACATT
ATAAAGCCAGGCTGTGTGAACACTGACCCGA
back to top